Le brevet du Coronavirus, Darpa et Bill Gates et sa fondation pour sauver le monde

Les questions, est-ce normal d'inventer des virus qui pourraient tuer des millions de personnes ou même anéantir toutes vies sur la terre ?

Un virus est une particule microscopique infectieuse qui ne peut se répliquer qu'en pénétrant dans une cellule et en utilisant sa machinerie cellulaire. Les virus qui infectent les bactéries sont les bactériophages. Il existe des virus qui infectent des animaux et d'autres qui infectent les végétaux. S'ils provoquent des maladies, les virus peuvent être considérés comme des germes pathogènes.

Devrions-nous inquiété sachant que qu'il y à un brevet au nom du Coronavirus, devrions-nous, nous inquiété que c'est un virus qui à été inventé dans un laboratoire ? Comme je ne suis pas un spécialiste des virus (virologue ou microbiologiste) je dois dire par contre, que moi, je suis inquiète, pourquoi ?

CORONAVIRUS a été financé, breveté par Welcomme Trust (Royaume-Uni, vendu à GlaxoSmithKline, l'un des dix géants de l'industrie pharmaceutique mondiale) financé par Bill & Melinda Gates Foundation, via son entreprise Breakthrough Energy Ventures et des investissements dans l'agence américaine DARPA (Defense Advanced Research Projects Agency, Darpa), de l'ordre de 1 milliard de dollars, DEFRA (Royaume-Uni), Organisation mondiale de la Santé, Commission européenne (UE) via THE PINBRIGHT INSTUTUTE (Royaume-Uni).

Le brevet CORONAVIRUS (du Royaume-Uni) a été approuvé en 17 mois par SERCO (Royaume-Uni) qui dirige le U.S. Patent Office. SERCO a utilisé son contrôle de l'Office américain des brevets pour délivrer à sa société britannique de bio un brevet sur le Coronavirus en un temps record.

L’armée américaine et Bill Gates investissent dans la manipulation génétique à grande échelle. L'entreprise de 1 milliard de dollars de Gates s'appelle Breakthrough Energy Ventures (Les  investisseurs incluent le fondateur et PDG de Facebook, Mark Zuckerberg. Le PDG d'Amazon, Jeff Bezos, et Richard Branson de Virgin Atlantic.

Breakthrough Energy Ventures

L'objectif de Breakthrough Energy est de faire en sorte que tout le monde sur Terre puisse profiter d'un bon niveau de vie - y compris l'accès à une alimentation saine, à une électricité de base, à des maisons confortables et à des transports pratiques - sans contribuer davantage au changement climatique.

Darpa

Vous connaissez les OGM ? Vous allez adorer le « forçage génétique ». L’Agence pour les projets de recherche avancée de la défense (Defense Advanced Research Projects Agency, Darpa), aurait investi EN 2017, 100 millions de dollars dans cette technique.

Le « forçage génétique » vise à modifier un gène et à faire en sorte que ce trait nouveau se transmette ensuite le plus rapidement possible à toute une espèce animale ou végétale, dans le but, par exemple, de limiter sa capacité de reproduction ou de la rendre plus vulnérable à une maladie ou à un produit chimique.

Pourquoi une agence militaire s'intéresse t-il au « forçage génétique » ?  Darpa répond que la manipulation génétique sont désormais devenues bon marché, ce qui multiplie les risques d’une expérimentation par des acteurs « hostiles » ou « voyous ». Darpa effectue cette recherche protéger contre une mauvaise utilisation accidentelle ou intentionnelle ».

« Il n’est pas possible de prédire les effets d’une modification génétique dans les écosystèmes sauvages, le danger c'est la diffusion de manière irréversible » et « franchir la barrière des espèces ». Le « forçage génétique » une nouvelle technologie puissante et dangereuse et des armes biologiques potentielles qui pourraient avoir des effets désastreux sur la paix, la sécurité sur la terre, si elles sont utilisées par de mauvaises mains».

Emerging Ag, une société privée de relations publiques, a reçu plus de 1,6 million de dollars de la Fondation Bill et Melinda Gates pour travailler sur des sujets liés à la recherche de gènes.

Le 18 février 2017, Bill Gates nous met en garde contre le bioterrorisme tuant 30 millions de personnes en un an et DARPA a déjà un projet de plateforme de prévention des pandémies pour développer une réponse aux nouveaux virus dans les 60 jours. «Il dit : il faut se préparer à une pandémie mondiale». 

«Le coût global de préparation à une pandémie est estimé à 3,4 milliards de dollars par an. La perte annuelle qu'une pandémie provoquerait pourrait atteindre 570 milliards»

«Il existait une vidéo dans laquelle il faisait une mise en garde, elle à été supprimé de Youtube au début du mois janvier 2020». Vous pouvez quand même visionner celle-ci :

Il y a quand même quelque chose de très incompréhensible quand Bille Gates parle de pandémies, parle de variole, Ebola, la grippe espagnol et Zika (arbovirus membre de la famille des Flaviviridae du genre Flavivirus), mais ne mentionne jamais qu'il a investi pour le brevet du Coronavirus, pourtant n'est-ce pas lui, grâce à ses milliards que ce brevet est sortie.

Des équipes de recherche de gènes (Target Malaria pour le Royaume-Uni et GBIRD, basé en Caroline du Nord) ont progressé vers la création d'organismes de recherche de gènes et se préparent pour des essais en plein air, y compris des étapes pour sélectionner des sites de test en Australie, En Nouvelle-Zélande, au Burkina Faso, en Ouganda, au Mali et au Ghana, des endroit vulnérable, infectation de la population des sites de tests ou une d'une pandémie non-maîtrisée mortelle. 

LA MALARIA : elle ne se transmet pas d’humain à humain. Ce sont des moustiques qui, en piquant des personnes déjà infectées, transmettent le parasite à d’autres personnes.

Target Malaria : Target Malaria est un projet lequel est soutenu par la Fondation Bill-et–Melinda Gates, Open Philanthropy Project ainsi que par les forces armées américaines (DARPA). Target Malaria« forçage génétique » visant à réduire la population de moustiques transmettant le paludisme en Afrique subsaharienne. En réduisant la population de moustiques du paludisme, nous visons à réduire la transmission de la maladie.

À propos du forçage génétique

Le forçage génétique est une technologie qui corrige et modifie génétiquement des populations entières d'insectes, de plantes, d'animaux et d'autres organismes.

Par exemple, Target Malaria a développé des forceurs génétiques qui se transmettront dans toute une population de moustiques rendant les femelles stériles, ce qui théoriquement amènerait à l’élimination de toutes les populations de moustiques qui s’accouplent avec des moustiques issus du forçage génétique ou de leurs descendants génétiques.

LE DANGER :  libérés à titre expérimental dans l'environnement, ces moustiques issus du forçage génétique pourraient transmettre leurs gènes modifiés à des espèces sauvages et domestiquées. Cela pourrait mener à la modification des systèmes écologiques et des réseaux alimentaires, nuire à la biodiversité et éradiquer des organismes utiles tels que les pollinisateurs.

Certaines compagnies ont déposé des brevets pour une utilisation commerciale du forçage génétique, y compris pour la manipulation du comportement des populations d'abeilles sauvages.

Ce qui est inquiétant, c'est surtout que Target Malaria semble avoir agi en hypocrite sans en glisser un mot sur les probables conséquences, le risque,  d'un tel projet, est-ce réellement dans l'espoir d'éradiqué le paludisme ou pour développer une bio-arme.

Des chercheurs, sur le programme de recherche de la Darpa visant à inoculer des gènes de résistance à des plantes via des insectes pourrait constituer une future arme biologique très puissante. L'armée américaine est en train de développer une future arme biologique d'une efficacité redoutable. Voilà en substance le cri d'alarme lancé par un collectif de scientifiques et de juristes dans le magazine Science le 4 octobre dernier.

Selon les signataires, ce procédé pourrait être détourné à des fins offensives pour détruire des cultures, par exemple en envoyant sur des champs sains un virus décimant une plante ciblée ou entraînant une stérilité des graines, ce qui pourrait engendrer une pénurie alimentaire à grande échelle. Les chercheurs vont même plus loin en affirmant que le programme contrevient à la convention sur les armes biologiques en 1975 et qui interdit le développement d'armes biologiques.

LE PROGRAMME INSECT ALLIES DE (DARPA) par le Dr. Blake Bextine biologiste.  DARPA met l'accent sur la biosécurité et la biosécurité dans cette recherche. Tous les travaux sont effectués à l'intérieur de laboratoires fermés, de serres ou d'autres installations sécurisées.

PROGRAMME DARPA :

(Darpa dispose d’un budget annuel de l’ordre de 2,9 milliards de dollars) Le programme créé en novembre 2016 et financé à hauteur de 27 millions de dollars (23 millions d'euros), Insect Allies travaille sur l'utilisation d'insectes porteurs de virus génétiquement modifiés capables d'infecter une plante pour altérer un ou plusieurs de ses gènes, une technique appelée Horizontal Environmental Genetic Alteration Agents (HEGAA). Contrairement aux OGM, il serait ainsi possible de changer les caractéristiques d'une plante en cours de saison pour la rendre résistante à une sécheresse passagère ou à une maladie.

Ce programme s’avère être extrêmement préoccupant.  En libérant des moustiques génétiquement modifiés, Target Malaria ouvre la voie à l’utilisation du forçage génétique, une technologie risquée qui a pour objectif l’élimination d’espèces entières.

Questions :

  1. Comment le recours à de telles techniques peut-il être compatible avec les pratiques agricoles habituelles ainsi qu’avec les normes de commerce et de régulation internationales concernant les organismes génétiquement modifiés ?
  2. Pourquoi dès lors avoir recours à des insectes pour protéger les cultures si cela reste très compliqué et que des méthodes plus simples existent déjà ?
  3. Convention sur l’interdiction des armes biologiques. Est-ce qu’utiliser des insectes pour propager des virus infectieux pourrait enfreindre l’article premier de la convention ?  Voir la Convention

Open Philanthropy : l'entreprise recherche identifie les opportunités de dons, accorde des subventions. Les principaux bailleurs de fonds sont Cari Tuna et Dustin Moskovitz, co-fondateur de Facebook et Asana (plateforme de gestion du travail).

En fin de compte, Bill Gate, nous il dit vouloir aider les gens à échapper à la pauvreté, promouvoir l'indépendance énergétique, réduire la pollution et éviter les pires effets du changement climatique. «Mais tous ces beaux projets ne concordent pas avec ce qu'il dit dans certains vidéos sur YouTube que vous pouvez visionner sur cette page.

Bill Gates affirme dans une autre vidéo que les vaccins peuvent aider à réduire la population mondiale.

Smith Kline, est le 2e groupe pharmaceutique mondial (56%) : destinés au traitement des maladies respiratoires. c'est une entreprise Canadienne qui produit des médicaments d’ordonnance, des vaccins et de produits de soins de santé aux consommateurs.  Pourquoi on à vendu à entreprise le brevet du coronavirus, que Bill Gates à financé ?, pourquoi cette entreprise à fabriqué un virus ?


Les virus à ARN présentent des taux de mutation très élevés, contrairement aux virus à ADN : la réplication est sensible aux erreurs, et ces virus ne possèdent pas les ADN polymérases permettant de détecter et corriger ces erreurs.

POLYMERASSE : un complexe enzymatique intervenant dans la réplication de l’ADN au cours du cycle cellulaire, mais aussi dans des processus de réparation et de recombinaison de l'ADN.

Sauver un virus doit toujours être soumises aux règles de manipulation génétique et aux niveaux de confinement appropriés utilisés.  C'est particulièrement le cas pour les virus qui est une arme potentielle de bioterrorisme. ( pour les virus qui peuvent être générés par des moyens génétiques inverses, les virus qui ont été générés en laboratoire, comme le conoravirus).

Voici la liste des médicaments vendu pas GlaxoSmithKline :

Advair :  25+250mcg inhalateur, deux médicaments qui agissent sur les bronches. Habituellement, on l'utilise pour contrôler l'asthme et prévenir les crises ou pour le traitement de la maladie pulmonaire obstructive chronique (MPOC). On peut sentir son action en quelques minutes.

Amerge : Le naratriptan est un médicament à base de triptan commercialisé par GlaxoSmithKline et qui est utilisé pour le traitement des migraines. C'est un agoniste sélectif du sous-type du récepteur 5-HT₁. Il a été breveté en 1987 et approuvé pour un usage médical en 1997.

Anoro Ellipta : on l'utilise pour le traitement de la maladie pulmonaire obstructive chronique (MPOC)

Arnuity Ellipta : un anti-inflammatoire de la famille de la cortisone (corticostéroïde). Habituellement, on l'utilise pour contrôler l'asthme et prévenir les crises. Il produit son plein effet après quelques jours.

Avamys : un anti-inflammatoire de la famille de la cortisone (corticostéroïde). Habituellement, on l'utilise pour la rhinite allergique.

Avandia : utilisé pour contrôler le taux de sucre dans le sang (glycémie) chez les personnes diabétiques.

Avodart : utilisé pour diminuer les symptômes d'hypertrophie de la prostate.

Benlysta : il s'agit d'un anticorps monoclonal. On l'utilise, en plus de traitements conventionnels, pour réduire les symptômes du lupus érythémateux disséminé.

Breo Ellipta : deux médicaments qui agissent sur les bronches. Habituellement, on l'utilise pour contrôler l'asthme et prévenir les crises ou pour le traitement de la maladie pulmonaire obstructive chronique (MPOC).

Ceftin:  un antibiotique de la famille des céphalosporines. Habituellement, on l'utilise pour combattre les infections.

Clavulin : un antibiotique de la famille des pénicillines. Habituellement, on l'utilise pour combattre les infections.

Frolan : est habituellement utilisé pour l'hypertension pulmonaire.

Flovent : un anti-inflammatoire de la famille de la cortisone (corticostéroïde). Habituellement, on l'utilise pour contrôler l'asthme et prévenir les crises.

Fortaz : un antibiotique de la famille des céphalosporines. Habituellement, on l'utilise pour combattre les infections.

Heptovir : est habituellement utilisé pour l'hépatite B.

Imitrex : est habituellement utilisé pour soulager les migraines.

Incruse Ellipta : est habituellement utilisé pour le traitement de la maladie pulmonaire obstructive chronique (MPOC).

Jalyn : tamsulosine est un médicament utilisé pour le traitement des symptômes associés à l'hypertrophie bénigne de la prostate (HBP) lorsqu'ils sont d'intensité modérée à importante.

Lamictal : est habituellement utilisé pour l'épilepsie.

Malarone : est habituellement utilisé pour traiter la malaria.

Mepron : est habituellement utilisé pour la pneumonie à pneumocystis (PCC).

Nucala : est habituellement utilisé pour contrôler les symptômes d'asthme.

Parnate : est habituellement utilisé pour la dépression.

Paxil : est habituellement utilisé pour la dépression ou pour des troubles d'anxiété généralisée.

Relenza : est habituellement utilisé pour la grippe (influenza).

Serevent : on l'utilise pour contrôler les symptômes d'asthme, pour l'emphysème ou pour la bronchite chronique.

Trelegy Ellipta : utilisé pour le traitement de la maladie pulmonaire obstructive chronique (MPOC).

Valtrex : utilisé pour l'herpès génital ou pour le zona. On l'emploie aussi pour les feux sauvages, ainsi que pour d'autres indications.

Ventolin : on l'utilise pour contrôler les symptômes d'asthme ou pour prévenir l'asthme à l'effort. On l'emploie aussi pour l'emphysème ou pour la bronchite chronique.

Volibris : utilisé pour l'hypertension pulmonaire.

Zejula : traitement d'entretien de patientes adultes atteintes d'un cancer épithélial séreux de haut grade de l'ovaire, des trompes de Fallope ou péritonéal primitif, sensible au platine et récidivant, qui sont en réponse (réponse complète ou partielle) à une chimiothérapie à base de platine.

Zofran : utilisé pour contrôler les nausées et les vomissements.

Zovirax : utilisé pour les feux sauvages.


Voici la liste des vaccins vendu pas GlaxoSmithKline :

Bexsero : Vaccin méningococcique.

Boostrix : vaccin contre la diphtérie, le tétanos et la coqueluche.

Boostrix Polio : contre l’infection causée par la diphtérie, le tétanos,la coqueluche et lapoliomyélite.

Cervarix : prévenir le cancer du col de l'utérus.

Engerix : permettant de développer une immunité contre l'hépatite B.

Flulaval Tetra : il s'utilise pour prévenir la grippe. La grippe est une maladie infectieuse courante causée par le virus influenza A et le virus influenza B.

Fluviral :  il s'utilise pour prévenir la grippe. La grippe est une maladie infectieuse courante causée par le virus influenza A et le virus influenza B.

Havrix :  Vaccin contre l’hépatite A.

Hiberix : on l'utilise pour prévenir certaines infections invasives (par ex. la méningite) qui sont causées par une bactérie de l'espèce Hæmophilus influenza type b (Hib) chez les nourrissons et les enfants âgés de 2 mois à 5 ans.

Infanrix : aide à protéger contre la diphtérie, le tétanos, la coqueluche, l'hépatite B, la polio et les infections causées par l'Hemophilus influenzae de type b (Hib) chez les nourrissons et les enfants âgés de 6 semaines à 2 ans.

Menjugate : prévient certaines infections comme la méningite et les infections du sang causées par les bactéries méningocoque de souche C (également appelées N. meningitidis du sérogroupe C).

Menveo : on l'utilise pour prévenir les infections méningococciques comme la méningite, la pneumonie et des infections du sang causées par les bactéries méningocoques des groupes A, C, Y et W-135.

Priorix : s'utilise pour prévenir une infection par le virus de la rougeole, des oreillons et de la rubéole.


Rabavert : on l'utilise pour prévenir la rage après une exposition au virus qui cause cette infection. On peut également l'utiliser pour prévenir cette infection avant une exposition au virus chez les personnes possédant un risque élevé d'être exposées à ce virus à cause de leur travail (par ex. les vétérinaires), de leurs déplacements, ou de leurs loisirs.

Rotarix : permettant de développer une immunité contre le rotavirus. (rotavirus est la principale cause de diarrhée abondante chez les bébés et les jeunes enfants)

Shingrix : s'utilise pour conférer une protection contre le zona aux personnes âgées de plus de 50 ans. Le zona est causé par le même virus que la varicelle.

Synflorix : On l'utilise pour prévenir la pneumonie (infection des poumons), la méningite (infections des membranes qui entourent le cerveau), l'empyème pleural (l'accumulation de pus dans l'espace entre les poumons et la paroi thoracique.)

Twinrix : utilisé chez les adultes, les adolescents, les enfants et les nourrissons pour prévenir l’hépatite A et l’hépatite B.

Varilrix : permettant de développer une immunité contre la varicelle.

UN LIEN INTÉRESSANT

Mais ce qui est intéressant c'est de voir un nom comme Raymond Castonguay figuré comme directeur de GlaxoSmithKline, mais ce qui est d'autant encore plus intéressant c'est de savoir que M Castonguay à déjà travaillé chez Genome Quebec et de retrouver Hélène Desmarais à la direction.

On retrouve aussi Paul L’Archevêque qui à été nommé pas l'ex ministre de la santé Gaétan Barrette,  Dirigeant de l’innovation en santé et en services sociaux, qui était avec Raymond Castonguay vice-président de l'entreprise GLAXO WELLCOME INC. Il a notamment occupé, de 2001 à 2009, la fonction de président-directeur général de Génome Québec.

Pourquoi avoir vendu le virus à Bill Gates de Microsoft ?

Le brevet sur le coronavirus a été délivré en seulement 17 mois à compter du dépôt initial - c'est presque, dû jamais vu! - avec très peu d'objection de la part de l'examinateur de brevets géré par SERCO (UK) Bao Q. Li.

La délivrance du brevet dure en moyenne 27 mois. Il est possible de diminuer ce délai à 20 mois. Pourquoi 17 mois et qu'est-ce qui pressait pour le virus ?

L'inventeur, « Pirbright »un centre mondial de la recherche,  entreprise qui « Prévient et contrôle les maladies virales » elle reçoit du financement du Conseil de recherche en biotechnologie et en sciences biologiques (BBSRC) cette entreprise offre du financement permettre aux individus et aux groupes de poursuivre des recherches en bioscience.

Bryan Charleston « Pirbright »

Liste des brevets attribués à THE PIRBRIGHT INSTITUTE (financé par Wellcome Trust, Bill & Melinda Gates Foundation, EU & DARPA)

The Pirbright Institute (Woking GB). (Compiled Jan. 28, 2020). Coronavirus et al Patent Assignee for Pat. Nos. 10,507,237; 10,294,277; 10,202,578; 10,130,701; 9,969,777; 9,457,075; 9,243,230; 9,145,548; 8,828,407; 8,501,466; 8,455,201. U.S. Patent Office.

https://www.fbcoverup.com/docs/library/2020-01-28-The-Pinbright-Institute-Woking-GB-Coronavirus-et-al-Patents-Assigned-to-AN_Pinbright-compiled-Jan-28-2020.pdf

Le contributeur,  majeur à Pirbright Institute,  est la Fondation Gates, dirigée par Bill et Melinda Gates.  Microsoft / Windows. Mais pourquoi est-ce un problème? Quel est le problème avec un couple riche qui contribue à prévenir les maladies infectieuses?

Disons-le de cette façon: Bill Gates a des opinions qui sont (légèrement) controversées. Il a enregistré des commentaires qui suggèrent d'être en faveur de la dépopulation humaine - en réduisant le nombre de personnes sur Terre. Serait-ce un moyen d'atteindre cet objectif?

L'attitude que Bill Gates apporte semble être obsessionnel et a-t-il pris des mesures direct pour reduire la population? Au lieu d'abaisser les taux de natalité, il existe peut-être une méthode plus simple et plus directe.

Une simulation a été imaginée sur un virus fictif appelé CAPS. L’analyse, réalisée dans le cadre d’une collaboration avec le Forum économique mondial et la Fondation Bill et Melinda Gates, a examiné ce qui se passerait si une pandémie se déclarait dans les élevages porcins du Brésil.

Il y a 3 mois, des experts en santé ont émis un avertissement inquiétant concernant une pandémie de coronavirus. Leur simulation a montré qu'elle pouvait tuer 65 millions de personnes.

Est-ce juste une coïncidence si cette «simulation» s'est produite quelques mois avant que le virus se répandre en Chine,  Ou s'agissait-il d'un test calculé?

On pourrait peu-êtres penser que Bill Gates à vu ce film fictif :

Les inventeurs du Coronavirus :

  • BICKERTON ERICA

  • BRITTON PAUL

 

  • KEEP SARAH

Biotechnology and Biological Sciences Research Council (BBSRC). Une entreprise qui à commencé ses opérations le 16 décembre 1996,  qui à juridiction au Royaume-Uni,  enregistré au nom du gouvernement, qui porte la Charte royale britannique, ( charte royale d'un monarque anglais, écossais ou britannique)  cette Charte remontant au XIIIe siècle.  L'objectif initial était de créer des sociétés publiques ou privées (y compris des villes et des cités), et de définir leurs privilèges et leur objectif. La charte royale est accordé par la Reine, qui confère une personnalité juridique indépendante à une organisation et définit ses objectifs, sa constitution et ses pouvoirs pour régir ses propres affaires.

En fait, ce que veut l'entreprise, elle cherche à changer les systèmes alimentaires et réduire la population, sauver la planète et que cela coute moins cher aux gouvernements.

Les maladies liées à l'alimentation sont nombreuses : épidémie d'obésité ou épidémie d'ostéoporose qui atteint l'Occident. Le diabète, les maladies cardiovasculaires et des cancers.  Les messages de santé publique se multiplient pour faire prendre conscience à la population du risque qu'elle représente si elle n'est pas bien gérée.

L'épidémiologie est l'étude historique des épidémies de maladies infectieuses et leur développement à travers les populations humaines mondiales.  On dit maintenant que nous sommes 7.2 milliards de personnes sur la terre et quand 2050 , il y en aura 2 milliards de plus et si on continue à manger de la même façon ça couterait encore plus cher, car il y aura plus de monde qui vont souffrir de mal nutrition.

DEFRA nous dit , (Royaume-Uni), Organisation mondiale de la Santé, Commission européenne (UE) via THE PINBRIGHT INSTUTUTE (Royaume-Uni).

Essayez seulement d'imaginer, si 3 milliards de personnes n'ont pas accès aux médicaments sur terre parce qu'ils sont pauvres, qu'ils souffrent de mal nutrition, s'ils n'ont pas les minéraux nécessaires à leurs croissances, on dit que cela à un impact sur la santé, l'environnement, peut entrainer des maladies cardiaques, des émissions à effet de serre, la production de viande, le, mais le blé et le riz, les espèces animales que nous mangeons, exemple (poulet, porc, vache,) les sources d'eau douce sèchent, ils sont pollués à 40% , les forêts tropicales disparaissent les plantes sont menacées, les glaciers fondent, les abeilles disparaissent, c'est le changement climatique, tout ça démontre que notre système alimentaire doit être changé.

Et tout ça à cause de la mal nutrition et un fort impact économique qui justifie toutes ces recherches.

THE PINBRIGHT INSTUTUTE

En 2007 Les britanniques s'efforcent d'identifier la source du foyer de fièvre aphteuse découvert dans un élevage bovin du Surrey, dans le sud de l'Angleterre, deux laboratoires de recherche situés à quelques kilomètres de la ferme contaminée sont visés.

  1. l'aboratoire géré par la société pharmaceutique Merial, propriété du groupe américain Merck
  2. Pirbright Instutute, possèdent différentes souches de la fièvre aphteuse afin de mener des recherches et d'élaborer un vaccin contre ce virus et d'autres maladies animales.

Plus de 6 millions et demi de bêtes avaient dû être abattues et incinérées, ce qui avait causé 12 milliards d'euros de pertes à l'économie britannique.

Est-ce que le virus hautement pathogène, transporté par le vent, peut s'échapper d'un site de recherche sous haute sécurité ?

SURVOLE DE GlaxoSmithKline

GlaxoSmithKline (GSK) La contreverse entourant le Seroxat, (La paroxétine, andidépresseur mis sur le marché en 1992) n'a pas cesser de devenir le médicament le plus rentable pour GSK à jamais produit, moins de 6 ans après son lancement, il est devenu le premier de l'entreprise, il à produit des milliards de dollars, c'était un triomphe.

Même seulement en quelques années le scepticisme presque critique de ce médicament qui aidait, soit disant, les phobies, troubles obsessionnels compulsifs, etc. Sauf que ce médicament n'était pas si promoteur qu'on le disait, il était plutôt dévastateur, on lui attribue de nombreux suicides.

Lorsqu'il a été commercialisé et sur le marché comme un médicament sûr, on pouvait prendre ce médicament sans aucun risque, sans devenir accro. Des personnes qui se sont fait prescrire Seroxat ont ressenti des étourdissements chaque fois qu'elles tentaient de cesser de l'utiliser, des symptômes de sevrage apparaissaient, les gens devenaient déprimés et suicidaires.

À la fin des années 1980, GlaxoSmithKline à financé des essaient clinique sur les effets de ce médicament sur des patients déprimés, l'homme qui était derrière ces essaient, était le professeur, Peter Tyra un expert mondial en toxicomanie. Il est venu à la conclusion que des millions de patients pouvaient prendre ce médicament, mais présenter les mêmes symptômes de sevrage.

Après les essaient cliniques, GlaxoSmithKline à conclu que ce médicament était quand, malgré la forme préoccupant des effets secondaires. Selon les études du professeur Tyra, les patients présentaient des symptômes dysphorie, d'anxiété et de pensées suicidaires, il était préoccupé par la nature des effets secondaires, voire même dangereux après ou pendant la prise du médicament.

C'était assez grave que les gens pensassent au suicide quand ils arrêtaient d'en prendre. Pour Peter Tyra il croyait qu'il était efficace, contre les pensées suicidaires. Peter Tyra n'a pas été plus loin dans la recherche des symptômes, il a dit à GlaxoSmithKline ce qu'il avait trouvé, mais l'entreprise n'était pas intéressée par les effets secondaires.

Peter Tera dit que GlaxoSmithKline n'a jamais voulu enquêter sur le problème, la société pharmaceutique s’en est lavé les mains.

Mais ce qu'on sait aujourd'hui, GlaxoSmithKline est en baisse, à cause des compétiteurs, les nouveaux produits, les génériques (brevet est valables 20 ans) qui ne plait pas aux investisseurs, sommes toute un bonne raison pour faire un brevet sur le coronavirus.

GlaxoSmithKline affirmait que ses dirigeants la Chine semblaient avoir enfreint la loi, un scandale de corruption, qui se traduirait par des baisses de ses opérations, le prix de ses médicaments en Chine. GSK versait des pots-de-vin à des fonctionnaires et des médecins, plus de 700 agences de voyages et de conseils pour gonfler le prix de vente de ses produits en Chine.

Une source proche de GSK déclare que le directeur Andrew Whitney dit que l'action est en baisse, une réponse aux allégations de corruption à son encontre.

Les brevets de médicaments arrivant à leur expiration, la concurrence venant des produits génériques, les découvertes de plus en plus rares de nouveaux médicaments et la baisse généralisée des ventes sont autant de phénomènes qui donnent un mal de bloc carabiné aux grands laboratoires pharmaceutiques.

En 2012 GlaxoSmithKline a payé la plus grosse amende de l'histoire, trois-milliards de dollars, une histoire qui concernait la promotion, publicités de certains médicaments utilisés comme le PAXIL, or ce médicament était vraiment bon pour les adolescents qui sont en dépressions.

GSK a promu l'idée dans toutes ses conventions médicales. En cinq ans GSK à vendu pour 28 milliards de dollars, est-ce que les pilules fonctionnaient pour ces enfants déprimés ? Non! mais les dirigeants ont reçu leurs primes. Pour la direction de GSK, il y avait tellement de preuves que la Food and Drug Administration (FDA) a été forcée d'agir. 5 ans plus tard, les sanctions étaient de l'ordre de 3 milliards pour la commercialisation d'un produit non médicamenteux, 2 milliards de dollars sont pour des amendes civiles impliquant une multitude de sociétés d'autres médicaments. 1 milliard de dollars pour les infractions pénales liées aux Paxil, Wellbutrin et Avandia.

La médecine est censée être sure et efficace. L'industrie pharmaceutique dit suivre les normes les plus élevées, mais les plus grands fabricants de médicaments au monde, une des filiales GlaxoSmithKline à plaidé coupable de distribution de drogue frelatés, certains des médicaments ont été contaminés par d'autres bactéries ont été mal étiquetées d'autres étaient trop fort ou pas assez fort.

Un essai clinique a montré que les adolescents qui prenaient le médicament (Paxil) pour dépression étaient plus susceptibles de tenter de se suicider que ceux qui prenaient des placébos. Oups

Il existe une liste ou on peut voir les médecins ayant été payés par GSK pour promotionner ces médicaments dangereux. GSK aurait donné en 2015 11 millions à des médecins italiens, plus de 13 millions en 2016, près de 15 millions en 2017 pour prescrire cela aux enfants.

De l'argent en échange de la vente des médicaments proposés ... y compris les vaccins.

En fait, GSK, haute direction a obtenu ses bonus, 25 milliards à tous ceux qui ont pris part à cette arnaque, un médicament qui aide à tuer vos enfants. Quand on mise beaucoup sur un produit qui va rapporter de l'argent, il est normal pour ce genre d'entreprise de taire les études négatives. L'interprétation des études, les résultats est souvent de se fermer les yeux, soulignée comme normal, on rend le message plus doux, même si les résultats tente à démontrer le danger pour la vie humaine.

Certains spécialistes vont jusqu'à prétendre que plusieurs entreprises comme GlaxoSmithKline risquent de disparaitre à cause des concurrents.

Comme si l'argent n'était pas le premier but d'une entreprise pharmaceutique, même après l'alerte lancée par Tyra GlaxoSmithKline a décidé quand même de vendre son produit, sans enquête.

UN PEU SUR L'AZT :

Souvenez-vous de ce médicament pour traiter le SIDA, on disait que les personnes atteintes de cette maladie prolongeraient leurs vies. Une fois que vous avez été diagnostiqué VIH, on vous disait de la prendre immédiatement , son cout en 1987 était de 10 000 dollars par année.

À SAVOIR : À l’issue des 20 années, le brevet tombe dans le domaine public et tout le monde est libre d’exploiter gratuitement cette invention.

LA BRONCHITE

La bronchite infectieuse est la maladie infectieuse la plus importante sur le plan économique (le vaccin est le plus payant). L'IBV (virus de la bronchite infectieuse aviaire) est répandu dans tous les types de volailles à l'échelle mondiale. C'est un agent pathogène aviaire hautement infectieux qui affecte l'appareil respiratoire, le tube digestif, les reins et le système reproducteur des poulets.

Qu’elle soit exactement le but, faut-il s'en inquiéter, parce qu'il est évident que toutes pandémies rendront des gens extrêmement riches. Pourrait-on seulement concevoir, que les concepteurs de ce virus avaient une idée derrière, une idée complètement, illogique et macabre, le début d'une guerre bactériologique ou une idée qui pourraient nous faire pensé au cinéma hollywoodien, comme les films sur les terrifiants virus.

Surtout quand on sait que le fameux vaccin prendrait plus d'un an avant de voir le jour : le monde pourrait se retrouver sans vaccin éprouvé pendant un an, alors que le virus se répand dans le monde entier.

La présente invention concerne un coronavirus vivant atténué comprenant un gène de réplicase variant codant pour des polyprotéines comprenant une mutation dans une ou plusieurs protéines non-structurales (nsp) -10, nsp-14, nsp-15 ou nsp-16. Ce coronavirus peut être utilisé en tant que vaccin pour le traitement et/ou la prévention d'une maladie, telle que la bronchite infectieuse, chez un sujet. Il faudrait plus d’un an pour tester le médicament sur des animaux avant qu’il ne soit adapté à l’homme.

RÉPLICASE : La réplicase est une protéine virale essentielle, dont le rôle est de copier le génome du virus.

PROTÉINE : Les protéines sont des molécules biologiques dont les activités peuvent être très variées.

Elles peuvent avoir :

  • un rôle structural (comme l'actine ou la tubuline qui participent à l'architecture de la cellule, la kératine qui constitue les cheveux) ;
  • un rôle enzymatique (comme l'ADN polymérase qui recopie l'ADN) ; enzyme est une protéine dotée de propriétés catalytiques (se réfère à l'accélération ou la réorientation de la cinétique de réaction au moyen d'un catalyseur) Un catalyseur est une espèce chimique qui permet d’augmenter la vitesse d’une réaction mais qui n’apparaît pas dans l’équation de cette réaction. Lorsqu’un catalyseur est utilisé pour accélérer une transformation, on dit que celle-ci est catalysée.

  • un rôle hormonal (comme l'insuline qui régule la glycémie) ;
  • un rôle moteur (comme la myosine qui transporte des molécules dans la cellule) Protéine qui joue un rôle important dans la contraction des muscles.

VOICI LE BREVET DU CORONAVIRUS ADAPTER POUR UNE COMPRÉHENSION À TOUT LE MONDE.

[1] CORONAVIRUS

[2] DOMAINE DE L'INVENTION

La présente invention concerne un coronavirus atténué comprenant un gène de réplicase variant, qui fait que le virus a une pathogénicité réduite ( capacité d'un agent infectieux de causer une maladie) La présente invention concerne également l'utilisation d'un tel coronavirus dans un vaccin pour prévenir et / ou traiter une maladie.


[3] CONTEXTE DE L'INVENTION

[4] Le virus de la bronchite infectieuse aviaire (IBV), l'agent étiologique de la bronchite infectieuse (IB), est un pathogène hautement infectieux et contagieux de la volaille domestique qui se réplique principalement dans les voies respiratoires mais aussi dans les cellules épithéliales de l'intestin, du rein et de l'oviducte. . IBV est membre de l'Ordre Nidovirales, (Les Nidovirales sont un ordre de virus) de la famille des Coronaviridae, de la sous-famille des Coronavirinae et du genre Gammacoronavirus; les coronavirus génétiquement très similaires provoquent des maladies chez les dindes, les pintades et les faisans. <--- (ici dans le texte de l'invention on ne parle pas d'humain, mais seulement d'animaux.)

Les Manchettes : (Ce sont des virus à ARN simple brin au sens positif, enveloppés, d'origine zoonotique. Les coronavirus infectent les animaux et les humains.)


[5] Les signes cliniques de l'IB comprennent les éternuements, les râles trachéaux, les écoulements nasaux et la respiration sifflante. Les oiseaux de type viande ont un gain de poids réduit, tandis que les oiseaux pondeurs pondent moins d'œufs et produisent des œufs de mauvaise qualité. L'infection respiratoire prédispose les poulets à des infections bactériennes secondaires qui peuvent être mortelles chez les poussins.

Le virus peut également causer des dommages permanents à l'oviducte, en particulier chez les poussins, entraînant une baisse de la production et de la qualité des œufs; et le rein, conduisant parfois à une maladie rénale qui peut être fatale. L'IBV serait responsable de plus de pertes économiques pour l'industrie de la volaille que toute autre maladie infectieuse.

Bien que les vaccins vivants atténués et les vaccins inactivés soient universellement utilisés dans la lutte contre les IBV, la protection acquise par l'utilisation de la vaccination peut être perdue soit en raison de la panne du vaccin, soit de l'introduction d'un nouveau sérotype IBV (nom que l'on donne à l'ensemble des caractéristiques antigéniques de certains micro-organismes, comme les bactéries) qui n'est pas lié au vaccin utilisé, ce qui pose un risque pour l'industrie de la volaille.

[6] En outre, il existe un besoin dans l'industrie de développer des vaccins pouvant être utilisés in ovo, afin d'améliorer l'efficacité et la rentabilité des programmes de vaccination. Un défi majeur associé à la vaccination in ovo est que le virus doit être capable de se répliquer en présence d'anticorps maternels contre le virus, sans être pathogène pour l'embryon.

Les vaccins IBV actuels sont dérivés après plusieurs passages dans des œufs embryonnés, ce qui se traduit par des virus avec une pathogénicité réduite pour les poulets, de sorte qu'ils peuvent être utilisés comme vaccins atténués vivants. Cependant, ces virus montrent presque toujours une virulence accrue pour les embryons et ne peuvent donc pas être utilisés pour la vaccination in ovo car ils entraînent une éclosion réduite. Une réduction de 70% de l'éclosion est observée dans certains cas.

IN OVO : En usage médical, il fait référence à la croissance de virus vivants dans des embryons d'oeufs de poule pour le développement de vaccins à usage humain, ainsi qu'à une méthode efficace de vaccination des volailles contre divers virus de la grippe aviaire et des coronavirus..

[7] L'atténuation suite au passage multiple dans des œufs embryonnés souffre également d'autres inconvénients. Il s'agit d'une méthode empirique,(qui s'appuie sur l'expérience, l'observation et non sur la théorie) car l'atténuation des virus est aléatoire et différera à chaque passage du virus, de sorte que le passage du même virus à travers une série d'oeufs différente à des fins d'atténuation conduira à un ensemble différent de mutations conduisant à l'atténuation.

Il existe également des problèmes d'efficacité associés au processus: certaines mutations affecteront la réplication du virus et certaines mutations peuvent rendre le virus trop atténué. Des mutations peuvent également se produire dans le gène S, ce qui peut également affecter l'immunogénicité,(la capacité qu'a un antigène de provoquer une réponse immunitaire bien spécifique)de sorte que la réponse immunitaire souhaitée est affectée et que le vaccin potentiel peut ne pas protéger contre le sérotype requis.

De plus, il y a des problèmes associés au retour à la virulence et à la stabilité des vaccins. Il est important que de nouveaux vaccins plus sûrs soient développés pour le contrôle de l'IBV. Il existe donc un besoin pour des vaccins contre l'IBV qui ne soient pas associés à ces problèmes, en particulier des vaccins pouvant être utilisés pour la vaccination in ovo.

[8] RÉSUMÉ DES ASPECTS DE L'INVENTION

[9] Les présents inventeurs ont utilisé une approche génétique inverse afin d'atténuer rationnellement l'IBV. Cette approche est beaucoup plus contrôlable que l'atténuation aléatoire après plusieurs passages dans des œufs embryonnés car la position de chaque mutation est connue et son effet sur le virus, c'est-à-dire la raison de l'atténuation, peut être dérivé.

[10] En utilisant leur approche génétique inverse, les présents inventeurs ont identifié diverses mutations qui font que le virus a des niveaux réduits de pathogénicité. Les niveaux de pathogénicité peuvent être réduits de telle sorte que lorsque le virus est administré à un œuf embryonné, il est capable de se répliquer sans être pathogène pour l'embryon. Ces virus peuvent convenir à une vaccination in ovo, ce qui est un avantage significatif et présente une amélioration par rapport aux vaccins IBV atténués produits après un passage multiple dans des œufs embryonnés.

[11] Ainsi, dans un premier aspect, la présente invention propose un coronavirus vivant atténué comprenant un gène de réplicase variant codant pour des polyprotéines comprenant une mutation dans une ou plusieurs protéines non structurales (nsp) -10, nsp-14, nsp-15 ou nsp-16. Le gène variant de la réplicase peut coder pour une protéine comprenant une ou plusieurs mutations d'acides aminés sélectionnées dans la liste de:

POLYPROTÉINES : Une polyprotéine est un long polypeptide produit par certains virus et à partir duquel les protéines virales sont produites sous l'action d'endopeptidases déjà présentes dans le virus ou la cellule hôte infectée

[12] Pro à Leu en position 85 de SEQ ID NO: 6,

[13] Val à Leu en position 393 de SEQ ID NO: 7;

[14] Leu se trouvant à la position 183 de SEQ ID NO: 8;

[15] Val se trouve à la position 209 de la SEQ ID NO: 9.

[16] Le gène de la réplicase peut coder une protéine comprenant la mutation en acides aminés Pro en Leu en position 85 de SEQ ID NO: 6.

[17] Le gène de la réplicase peut coder pour une protéine comprenant les mutations d'acides aminés Val en Leu en position 393 de SEQ ID NO: 7; Leu à IIe en position 183 de SEQ ID NO: 8; et Val se trouve à la position 209 de SEQ ID NO: 9.

MUTATION : mutation est une modification rare, accidentelle ou provoquée, de l'information génétique (séquence d'ADN ou d'ARN) dans le génome

[18] Le gène de la réplicase peut coder pour une protéine comprenant les mutations d'acides aminés Pro en Leu en position 85 de SEQ ID NO: 6; Val à Leu en position 393 de SEQ ID NO: 7; Leu se trouve à la position 183 de SEQ ID NO: 8; et Val se trouvant à la position 209 de SEQ ID NO: 9. Le gène de la réplicase peut comprendre une ou plusieurs substitutions nucléotidiques sélectionnées dans la liste de:

[19] C à T à la position nucléotidique 12137;

NUCLÉOTIDIQUES : un nucléotide est une molécule organique qui est l'élément de base d'un acide nucléique tel que l'ADN ou l'ARN. Il est composé d'une base nucléique, d'un ose à cinq atomes de carbone, dit pentose, dont l'association forme un nucléoside, et enfin de un à trois groupes phosphate

[20] G à C à la position nucléotidique 18114;

[21] T à A à la position nucléotidique 19047; et

[22] G à A en position nucléotidique 20139;

[23] par rapport à la séquence représentée par SEQ ID NO: 1.

[24] Le coronavirus peut être un virus de la bronchite infectieuse (IBV). Le coronavirus peut être IBV M41.

[25] Le coronavirus peut comprendre une protéine S dont au moins une partie provient d'un sérotype IBV autre que M41. Par exemple, la sous-unité S1 ou la protéine S entière peut provenir d'un sérotype IBV autre que M41.

Le coronavirus selon le premier aspect de l'invention a une pathogénicité réduite par rapport à un coronavirus exprimant une réplicase de type sauvage correspondante, de sorte que lorsque le virus est administré à un œuf embryonné, il est capable de se répliquer sans être pathogène pour l'embryon.

[26] Dans un deuxième aspect, la présente invention propose un gène de réplicase variant tel que défini en relation avec le premier aspect de l'invention. Dans un troisième aspect, la présente invention fournit une protéine codée par un gène de réplicase de coronavirus variant selon le deuxième aspect de l'invention.

[27] Dans un quatrième aspect, la présente invention propose un plasmide comprenant un gène de réplicase selon le deuxième aspect de l'invention.

PLASMIDE : En microbiologie et en biologie moléculaire, un plasmide est une molécule d'ADN distincte de l'ADN chromosomique, capable de réplication autonome et non essentielle à la survie de la cellule. Les plasmides sont bicaténaires et généralement circulaires.

Élément génétique du cytoplasme (séparé et indépendant du chromosome), hébergé par un hôte bactérien et dont la réplication est autonome.

[28] Dans un cinquième aspect, la présente invention propose un procédé de fabrication du coronavirus selon le premier aspect de l'invention qui comprend les étapes suivantes:

[29] (i) transfecter un plasmide selon le quatrième aspect de l'invention dans une cellule hôte;

[30] (ii) infecter la cellule hôte avec un virus recombinant comprenant le génome d'une souche de coronavirus avec un gène de réplicase;

[31] (iii) permettre à la recombinaison homologue de se produire entre les séquences du gène de la réplicase dans le plasmide et les séquences correspondantes dans le génome du virus recombinant pour produire un gène de la réplicase modifié; et

[32] (iv) sélectionner pour recombiner un virus comprenant le gène de réplicase modifié.

[33] Le virus recombinant peut être un virus de la vaccine.

[34] La méthode peut également comprendre l'étape:

[35] (v) récupérer le coronavirus recombinant comprenant le gène de réplicase modifié à partir de l'ADN du virus recombinant de l'étape (iv).

[36] Dans un sixième aspect, la présente invention propose une cellule capable de produire un coronavirus selon le premier aspect de l'invention.

[37] Dans un septième aspect, la présente invention propose un vaccin comprenant un coronavirus selon le premier aspect de l'invention et un support pharmaceutiquement acceptable. Dans un huitième aspect, la présente invention propose un procédé de traitement et / ou de prévention d'une maladie chez un sujet qui comprend l'étape d'administration d'un vaccin selon le septième aspect de l'invention au sujet.

[38] D'autres aspects de l'invention fournissent:

[39]  le vaccin selon le septième aspect de l'invention pour une utilisation dans le traitement et / ou la prévention d'une maladie chez un sujet.

[40] utilisation d'un coronavirus selon le premier aspect de l'invention dans la fabrication d'un vaccin pour traiter et / ou prévenir une maladie chez un sujet.

[41] La maladie peut être une bronchite infectieuse (IB).

[42] Le mode d'administration du vaccin peut être choisi dans le groupe constitué de; administration de collyre, (médicament liquide pour l'œil)administration intranasale, administration d'eau potable, injection post-éclosion et injection in ovo.

[43] La vaccination peut se faire par vaccination in ovo. La présente invention propose également un procédé de production d'un vaccin selon le septième aspect de l'invention, qui comprend l'étape d'infecter une cellule selon le sixième aspect de l'invention avec un coronavirus selon le premier aspect de l'invention. DESCRIPTION DES FIGURES

[44] Figure 1 - Cinétique de croissance de M41-R-6 et M41 -R-12 par rapport à M41-CK (M41 EP4) sur les cellules CK Figure 2 - Signes cliniques, snicking et respiration sifflante, associés à M41 -R-6 et M41 -R-12 par rapport à M41 -CK (M41 EP4) et Beau-R (les barres montrent la maquette, Beau-R, M41-R 6, M41- R 12, M41-CK EP4 de gauche à droite de chaque point de temps).

[45] Figure 3 - Activité ciliaire des virus dans les anneaux trachéaux isolés de trachées prélevées sur des poussins infectés. 100% d'activité ciliaire n'indique aucun effet du virus; apathogène, 0% d'activité indique une perte complète de l'activité ciliaire, une ciliostase complète, indiquant que le virus est pathogène (les barres montrent une maquette, Beau-R, M41-R 6, M41 -R 12, M41 -CK EP4 de gauche à droite de chaque point de temps ).

Figure 4 - Signes cliniques, snicking, associés à M41 R-nsp10rep et M41 R- nsp14,15,16rep par rapport à M41 -R-12 et M41 -CK (M41 EP5) (les barres montrent une simulation, M41 - R12; M41 R- nsp10rep; M41 R-nsp14,15,16rep et M41 -CK EP5 de gauche à droite de chaque point de temps).

[46] Figure 5 - Activité ciliaire de M41 R-nsp10rep et M41 R-nsp14,15,16rep par rapport à M41-R-12 et M41-CK dans des anneaux trachéaux isolés de trachées prélevées sur des poussins infectés (les barres montrent une maquette; M41- R12; M41 R-nsp10rep; M41 R-nsp14,15,16rep et M41 -CK EP5 de gauche à droite de chaque point de temps).

[47] Figure 6 - Signes cliniques, snicking, associés à M41 R-nsp10, 15rep, M41 R-nsp10, 14, 15rep, M41 R-nsp10, 14, 16rep, M41 R-nsp10, 15, 16rep et M41 -K par rapport à M41 -CK (les barres présentent une maquette, M41 R-nsp10,15rep1; M41 R-nsp10,14,16rep4; M41 R-nsp10,15,16rep8; M41 R-nsp10,14,15rep10; M41 -K6 et M41 - CK EP4 de gauche à droite de chaque point de temps).

[48] ​​Figure 7 - Signes cliniques, respiration sifflante, associés à M41 R-nsp10, 15rep, M41 R-nsp10, 14, 15rep, M41 R-nsp10, 14, 16rep, M41 R-nsp10, 15, 16rep et M41-K par rapport à M41-CK (les barres montrent une maquette, M41 R-nsp10,15rep1; M41 R-nsp10,14,16rep4; M41 R- nspl 0,15,16rep8; M41 R-nsp10,14,15rep10; M41 -K6 et M41 -CK EP4 de gauche à droite de chaque point de temps).

[49] Figure 8 - Activité ciliaire de M41 R-nsp10, 15rep, M41 R-nsp10, 14, 15rep, M41 R-nsp10,

[50] 14, 16rep, M41 R-nsp10, 15, 16rep et M41 -K par rapport à M41-CK dans des anneaux trachéaux isolés de trachées prélevées sur des poussins infectés (les barres montrent une maquette, M41 R-nsp10,15rep1;

[51] M41 R-nsp10, 14, 16 rep4; M41 R-nsp10,15,16rep8; M41 R-nsp10,14,15rep10; M41-K6 et M41-CK EP4 de gauche à droite de chaque point de temps).

[52] Figure 9 - Cinétique de croissance des rIBV par rapport à M41 -CK sur les cellules CK. La figure 9A montre les résultats pour M41 -R et M41 -K. La figure 9B montre les résultats pour M41 -nspl 0 rep; M41 R-nsp14,

[53] 15, 16 rep; M41 R-nsp10, 15 répétitions; M41 R-nsp10, 15, 16 rep; M41 R-nsp10, 14, 15 rep; et M41 R-nsp10, 14, 16.

[54] Figure 10 - Position des mutations d'acides aminés dans les séquences mutées nsp10, nsp14, nsp15 et nsp16. Figure 11 - A) Snicking; B) Symptômes respiratoires (respiration sifflante et râles combinés) et C) Activité ciliaire des rIBV M41 R-nsp 10,14 rep et rIBV M41 R-nsp 10,16 rep par rapport à M41 -CK (les barres montrent une maquette, M41 R-nsp10, 14rep; M41 R-nsp10,16rep et M41 -K de gauche à droite de chaque point de temps).

[55] DESCRIPTION DÉTAILLÉE

[56] La présente invention fournit un coronavirus comprenant un gène de réplicase variant qui, lorsqu'il est exprimé dans le coronavirus, fait que le virus a une pathogénicité réduite par rapport à un coronavirus correspondant qui comprend le gène de réplicase de type sauvage.

[57] CORONAVIRUS

[58] Le Gammacoronavirus est un genre de virus animal appartenant à la famille des Coronaviridae. Les coronavirus sont des virus enveloppés avec un génome d'ARN simple brin de sens positif et une symétrie hélicoïdale.

[59] La taille génomique des coronavirus varie d'environ 27 à 32 kilobases, ce qui est la taille la plus longue pour tout virus à ARN connu.

[60] Les coronavirus infectent principalement les voies respiratoires ou gastro-intestinales supérieures des mammifères et des oiseaux. Cinq à six souches différentes de coronavirus actuellement connues infectent l'homme. Le coronavirus humain le plus connu, le SRAS-CoV qui provoque le syndrome respiratoire aigu sévère (SRAS), a une pathogenèse unique car il provoque à la fois des infections des voies respiratoires supérieures et inférieures et peut également provoquer une gastro-entérite. Le coronavirus du syndrome respiratoire du Moyen-Orient (MERS-CoV) provoque également une infection des voies respiratoires inférieures chez l'homme. On pense que les coronavirus causent un pourcentage important de tous les rhumes communs chez les adultes humains. Les coronavirus provoquent également une série de maladies chez les animaux d'élevage et les animaux domestiques, dont certaines peuvent être graves et constituent une menace pour l'industrie agricole. Les coronavirus économiquement significatifs des animaux d'élevage comprennent le virus de la bronchite infectieuse (IBV) qui provoque principalement des maladies respiratoires chez les poulets et affecte gravement l'industrie de la volaille dans le monde; coronavirus porcin (gastro-entérite transmissible, TGE) et coronavirus bovin, qui provoquent tous deux la diarrhée chez les jeunes animaux. Le coronavirus félin a deux formes, le coronavirus entérique félin est un pathogène d'importance clinique mineure, mais une mutation spontanée de ce virus peut entraîner une péritonite infectieuse féline (PIF), une maladie associée à une mortalité élevée. Il existe également deux types de coronavirus canin (CCoV), l'un qui provoque une maladie gastro-intestinale bénigne et l'autre qui s'est avéré causer une maladie respiratoire. Le virus de l'hépatite murine (MHV) est un coronavirus qui provoque une maladie épidémique murine avec une mortalité élevée, en particulier parmi les colonies de souris de laboratoire.

[61] Les coronavirus sont divisés en quatre groupes, comme indiqué ci-dessous:

[62] Alpha

[63] Coronavirus canin (CCoV)

[64] Coronavirus félin (FeCoV)

[65] Coronavirus humain 229E (HCoV-229E)

[66] Virus de la diarrhée épidémique porcine (PEDV)

[67] Virus de la gastro-entérite transmissible (TGEV)

[68]  Coronavirus humain NL63 (NL ou New Haven)

[69] Bêta

[70]  Coronavirus bovin (BCoV)

[71] Coronavirus respiratoire canin (CRCoV) - Commun en Asie du Sud-Est et en Micronésie

[72] Coronavirus humain OC43 (HCoV-OC43)

[73] Virus de l'hépatite de souris (MHV)

[74] Virus de l'encéphalomyélite hémagglutinante porcine (VHE)

[75] Coronavirus de rat (RCV). Le coronavirus du rat est assez répandu dans l'est de l'Australie où, en mars / avril 2008, il a été trouvé parmi les colonies de rongeurs indigènes et sauvages.

[76] (Pas de nom usuel pour le moment) (HCoV-HKU1)

[77] Coronavirus du syndrome respiratoire aigu sévère (SRAS-CoV)

[78] Coronavirus du syndrome respiratoire du Moyen-Orient (MERS-CoV)

[79] Gamma

[80] Virus de la bronchite infectieuse (IBV)

[81] Coronavirus de la Turquie (virus de la maladie de Bluecomb)

[82] Coronavirus de faisan

[83] Coronavirus de pintade

[84] Delta Bulbul coronavirus (BuCoV)

[85] Coronavirus du muguet (ThCoV)

[86] Munia coronavirus (MuCoV)

[87] Coronavirus porcin (PorCov) HKU15

[88] Le gène de réplicase variant du coronavirus de la présente invention peut être dérivé d'un alphacoronavirus tel que le TGEV; un bétacoronavirus tel que le MHV; ou un gammacoronavirus tel que IBV.

[89] Tel qu'utilisé ici, le terme "dérivé de" signifie que le gène de la réplicase comprend sensiblement la même séquence nucléotidique que le gène de la réplicase de type sauvage du coronavirus pertinent. Par exemple, le gène variant de réplicase de la présente invention peut avoir jusqu'à 80%, 85%, 90%, 95%, 98% ou 99% d'identité avec la séquence de réplicase de type sauvage. Le gène variant de la réplicase du coronavirus code pour une protéine comprenant une mutation dans une ou plusieurs des protéines non structurales (nsp) -10, nsp-14, nsp-15 ou nsp-16 par rapport à la séquence de type sauvage de la séquence non structurale protéine.

[90] IBV

[91] La bronchite infectieuse aviaire (IB) est une maladie respiratoire aiguë et très contagieuse des poulets qui entraîne des pertes économiques importantes. La maladie se caractérise par des signes respiratoires tels que halètement, toux, éternuements, râles trachéaux et écoulement nasal. Chez les jeunes poulets, une détresse respiratoire sévère peut survenir. En couches, la détresse respiratoire, la néphrite, la diminution de la production d'œufs et la perte de la qualité interne des œufs et de la coquille des œufs sont courantes.

[92] Chez les poulets de chair, la toux et les cliquetis sont des signes cliniques courants, se propageant rapidement chez tous les oiseaux des lieux. La morbidité est de 100% dans les troupeaux non vaccinés. La mortalité varie en fonction de l'âge, de la souche virale et des infections secondaires, mais peut atteindre jusqu'à 60% dans les troupeaux non vaccinés.

[93] Le premier sérotype IBV identifié a été le Massachusetts, mais aux États-Unis, plusieurs sérotypes, dont l'Arkansas et le Delaware, circulent actuellement, en plus du type du Massachusetts initialement identifié. La souche IBV Beaudette a été dérivée après au moins 150 passages dans des embryons de poulet. IBV Beaudette n'est plus pathogène pour les poulets éclos mais tue rapidement les embryons.

[94] H120 est une souche vaccinale commerciale atténuée du sérotype IBV du Massachusetts, atténuée par environ 120 passages dans des œufs de poule embryonnés. Le H52 est un autre vaccin du Massachusetts et représente un virus de passage antérieur et légèrement plus pathogène (passage 52) lors du développement de H120. Les vaccins à base de H120 sont couramment utilisés. IB QX est un isolat virulent de champ d'IBV. Il est parfois connu sous le nom de «QX chinois» car il a été isolé à l'origine à la suite d'épidémies dans la région de Qingdao en Chine au milieu des années 1990.

Depuis lors, le virus s'est glissé vers l'Europe. Depuis 2004, de graves problèmes de production d'œufs ont été identifiés avec un virus très similaire dans certaines parties de l'Europe occidentale, principalement aux Pays-Bas, mais également signalé en Allemagne, en France, en Belgique, au Danemark et au Royaume-Uni.

[95] Le virus isolé des cas néerlandais a été identifié par le Dutch Research Institute de Deventer comme une nouvelle souche qu'ils ont appelée D388. La connexion chinoise est venue d'autres tests qui ont montré que le virus était similaire à 99% aux virus chinois QX. Une souche de vaccin IBV vivant atténué de type QX a maintenant été développée.

[96] IBV est un virus enveloppé qui se réplique dans le cytoplasme cellulaire et contient un génome d'ARN sens positif non segmenté, simple brin. IBV possède un génome à ARN de 27,6 kb et, comme tous les coronavirus, contient les quatre protéines structurales; glycoprotéine de pointe (S), petite protéine membranaire (E), protéine membranaire intégrale (M) et protéine nucléocapside (N) qui interagit avec l'ARN génomique.

[97] Le génome est organisé de la manière suivante: 5'UTR - gène de polymérase (réplicase) - gènes de protéine structurale (S-E-M-N) - UTR 3 '; où l'UTR sont des régions non traduites (chacune ~ 500 nucléotides dans IBV).

[98] L'enveloppe lipidique contient trois protéines membranaires: S, M et E. La protéine IBV S est une glycoprotéine de type I qui oligomérise dans le réticulum endoplasmique et est assemblée en homotrimère inséré dans la membrane du virion via le domaine transmembranaire et est associée par interactions non covalentes avec la protéine M. Après incorporation dans des particules de coronavirus, la protéine S est responsable de la liaison au récepteur cellulaire cible et de la fusion des membranes virales et cellulaires.

La glycoprotéine S se compose de quatre domaines: une séquence signal qui est clivée pendant la synthèse; l'ectodomaine, qui est présent à l'extérieur de la particule de virion; la région transmembranaire responsable de l'ancrage de la protéine S dans la bicouche lipidique de la particule de virion; et la queue cytoplasmique. Tous les coronavirus codent également pour un ensemble de gènes protéiques accessoires de fonction inconnue qui ne sont pas nécessaires à la réplication in vitro, mais peuvent jouer un rôle dans la pathogenèse. L'IBV code pour deux gènes accessoires, les gènes 3 et 5, qui expriment tous deux respectivement deux protéines accessoires 3a, 3b et 5a, 5b. Le gène variant de réplicase du coronavirus de la présente invention peut être dérivé d'un IBV. Par exemple, l'IBV peut être IBV Beaudette, H120, H52, IB QX, D388 ou M41.

[99] L'IBV peut être l'IBV M41. M41 est un sérotype prototypique du Massachusetts qui a été isolé aux États-Unis en 1941. Il s'agit d'un isolat utilisé dans de nombreux laboratoires à travers le monde comme colorant de laboratoire pathogène et peut être obtenu auprès de l'ATCC (V.

[100] La séquence du génome d'IBV M41 -CK est fournie en tant que SEQ ID NO: 1.

[101] SEQ ID NO: 1 séquence IBV M41 -CK

[102] ACTTAAGATAGATATTA ATATATATCTATCACACTAGCCTTGCGCTAGATTTCCAACTTA ACAAAACGGACTTAAATACCTACAGCTGGTCCTCATAGGTGTTCCATTGCAGTGCACTTT AGTGCCCTGGATGGCACCTGGCCACCTGTCAGGTTTTTGTTATTAAAATCTTATTGTTGC TGGTATCACTGCTTGTTTTGCCGTGTCTCACTTTATACATCCGTTGCTTGGGCTACCTAG TATCCAGCGTCCTACGGGCGCCGTGGCTGGTTCGAGTGCGAAGAACCTCTGGTTCATCTA GCGGTAGGCGGGTGTGTGGAAGTAGCACTTCAGACGTACCGGTTCTGTTGTGTGAAATAC GGGGTCACCTCCCCCCACATACCTCTAAGGGCTTTTGAGCCTAGCGTTGGGCTACGTTCT CGCATAAGGTCGGCTATACGACGTTTGTAGGGGGTAGTGCCAAACAACCCCTGAGGTGAC AGGTTCTGGTGGTGTTTAGTGAGCAGACATACAATAGACAGTGACAACATGGCTTCAAGC CTAAAACAGGGAGTATCTCCCAAACTAAGGGATGTCATTCTTGTATCCAAAGACATTCCT GAACAACTTTGTGACGCTTTGTTTTTCTATACGTCACACAACCCTAAGGATTACGCTGAT GCTTTTGCAGTTAGGCAGAAGTTTGATCGTAATCTGCAGACTGGGAAACAGTTCAAATTT GAAACTGTGTGTGGTCTCTTCCTCTTGAAGGGAGTTGACAAAATAACACCTGGCGTCCCA GCAAAAGTCTTAAAAGCCACTTCTAAGTTGGCAGATTTAGAAGACATCTTTGGTGTCTCT CCCTTTGCAAGAAAATATCGTGAACTTTTGAAGACAGCATGCCAGTGGTCTCTTACTGTA GAAACACTGGATGCTCGTGCACAAACTCTTGATGAAATTTTTGACCCTACTGAAATACTT TGGCTTCAGGTGGCAGC AAAAATCCAAGTTTCGGCTATGGCGATGCGCAGGCTTGTTGGA GAAGTAACTGCAAAAGTCATGGATGCTTTGGGCTCAAATATGAGTGCTCTTTTCCAGATT TTTAAACAACAAATAGTCAGAATTTTTCAAAAAGCGCTGGCTATTTTTGAGAATGTGAGT GAATTACCACAGCGTATTGCAGCACTTAAGATGGCTTTTGCTAAGTGTGCCAAGTCCATT ACTGTTGTGGTTATGGAGAGGACTCTAGTTGTTAGAGAGTTCGCAGGAACTTGTCTTGCA AGCATTAATGGTGCTGTTGCAAAATTCTTTGAAGAACTCCCAAATGGTTTCATGGGTGCT AAAATTTTCACTACACTTGCCTTCTTTAGGGAGGCTGCAGTGAAAATTGTGGATAACATA CCAAATGCACCGAGAGGCACTAAAGGGTTTGAAGTCGTTGGTAATGCCAAAGGTACACAA GTTGTTGTGCGTGGCATGCGAAATGACTTAACACTGCTTGACCAAAAAGCTGAAATTCCT GTGGAGTCAGAAGGTTGGTCTGCAATTTTGGGTGGACATCTTTGCTATGTCTTTAAGAGT GGTGATCGCTTTTACGCGGCACCTCTTTCAGGAAATTTTGCATTGCATGATGTGCATTGT TGTGAGCGTGTTGTCTGTCTTTCTGATGGTGTAACACCGGAGATAAATGATGGACTTATT CTTGCAGCAATCTACTCTTCTTTTAGTGTCGCAGAACTTGTGGCAGCCATTAAAAGGGGT GAACCATTTAAGTTTCTGGGTCATAAATTTGTGTATGCAAAGGATGCAGCAGTTTCTTTT ACATTAGCGAAGGCTGCTACTATTGCAGATGTTTTGAAGCTGTTTCAATCAGCGCGTGTG AAAGTAGAAGATGTTTGGTCTTCACTTACTGAAAAGTCTTTTGAATTCTGGAGGCTTGCA TATGGAAAAGTGCGTAATCTCGAAGAATTTGTTAAGACTTG TTTTTGTAAGGCTCAAATG GCGATTGTGATTTTAGCGACAGTGCTTGGAGAGGGCATTTGGCATCTTGTTTCGCAAGTC ATCTATAAAGTAGGTGGTCTTTTTACTAAAGTTGTTGACTTTTGTGAAAAATATTGGAAA GGTTTTTGTGCACAGTTGAAAAGAGCTAAGCTCATTGTCACTGAAACCCTCTGTGTTTTG AAAGGAGTTGCACAGCATTGTTTTCAACTATTGCTGGATGCAATACAGTTTATGTATAAA AGTTTTAAGAAGTGTGCACTTGGTAGAATCCATGGAGACTTGCTCTTCTGGAAAGGAGGT GTGCACAAAATTATTCAAGAGGGCGATGAAATTTGGTTTGACGCCATTGATAGTATTGAT GTTGAAGATCTGGGTGTTGTTCAAGAAAAATTGATTGATTTTGATGTTTGTGATAATGTG ACACTTCCAGAGAACCAACCCGGTCATATGGTTCAAATCGAGGATGACGGAAAGAACTAC ATGTTCTTCCGCTTCAAAAAGGATGAGAACATTTATTATACACCAATGTCACAGCTTGGT GCTATTAATGTGGTTTGCAAAGCAGGCGGTAAAACTGTCACCTTTGGAGAAACTACTGTG CAAGAAATACCACCACCTGATGTTGTGTTTATTAAGGTTAGCATTGAGTGTTGTGGTGAA CCATGGAATACAATCTTCAAAAAGGCTTATAAGGAGCCCATTGAAGTAGAGACAGACCTC ACAGTTGAACAATTGCTCTCTGTGGTCTATGAGAAAATGTGTGATGATCTCAAGCTGTTT CCGGAGGCTCCAGAACCACCACCATTTGAGAATGTCACACTTGTTGATAAGAATGGTAAA GATTTGGATTGCATAAAATCATGCCATCTGATCTATCGTGATTATGAGAGCGATGATGAC ATCGAGGAAGAAGATGCAGAAGAATGTGACACGGATTCAGGTGATGCTGAGGAGTGTGAC ACTA ATTCAGAATGTGAAGAAGAAGATGAGGATACTAAAGTGTTGGCTCTTATACAAGAC CCGGCAAGTAACAAATATCCTCTGCCTCTTGATGATGATTATAGCGTCTACAATGGATGT ATTGTTCATAAGGACGCTCTCGATGTTGTGAATTTACCATCTGGTGAAGAAACCTTTGTT GTCAATAACTGCTTTGAAGGGGCTGTTAAAGCTCTTCCGCAGAAAGTTATTGATGTTCTA GGTGACTGGGGTGAGGCTGTTGATGCGCAAGAACAATTGTGTCAACAAGAATCAACTCGG GTCATATCTGAGAAATCAGTTGAGGGTTTTACTGGTAGTTGTGATGCAATGGCTGAACAA GCTATTGTTGAAGAGCAGGAAATAGTACCTGTTGTTGAACAAAGTCAGGATGTAGTTGTT TTTACACCTGCAGACCTAGAAGTTGTTAAAGAAACAGCAGAAGAGGTTGATGAGTTTATT CTCATTTCTGCTGTCCCTAAAGAAGAAGTTGTGTCTCAGGAGAAAGAGGAGCCACAGGTT GAGCAAGAGCCTACCCTAGTTGTTAAAGCACAACGTGAGAAGAAGGCTAAAAAGTTCAAA GTTAAACCAGCTACATGTGAAAAACCCAAATTTTTGGAGTACAAAACATGTGTGGGTGAT TTGGCTGTTGTAATTGCCAAAGCATTGGATGAGTTTAAAGAGTTCTGCATTGTAAACGCT GCAAATGAGCACATGTCGCATGGTGGTGGCGTTGCAAAGGCAATTGCAGACTTTTGTGGA CCGGACTTTGTTGAATATTGCGCGGACTATGTTAAGAAACATGGTCCACAGCAAAAACTT GTCACACCTTCATTTGTTAAAGGCATTCAATGTGTGAATAATGTTGTAGGACCTCGCCAT GGAGACAGCAACTTGCGTGAGAAGCTTGTTGCTGCTTACAAGAGTGTTCTTGTAGGTGGA GTGGTTAACTATGTTGTGCCAGTTCTCT CATCAGGGATTTTTGGTGTAGATTTTAAAATA TCAATAGATGCTATGCGCGAAGCTTTTAAAGGTTGTGCCATACGCGTTCTTTTATTTTCT CTGAGTCAAGAACACATCGATTATTTCGATGCAACTTGTAAGCAGAAGACAATTTATCTT ACGGAGGATGGTGTTAAATACCGCTCTGTTGTTTTAAAACCTGGTGATTCTTTGGGTCAA TTTGGACAGGTTTTTGCAAGAAATAAGGTAGTCTTTTCGGCTGATGATGTTGAGGATAAA GAAATCCTCTTTATACCCACAACTGACAAGACTATTCTTGAATATTATGGTTTAGATGCG CAAAAGTATGTAACATATTTGCAAACGCTTGCGCAGAAATGGGATGTTCAATATAGAGAC AATTTTGTTATATTAGAGTGGCGTGACGGAAATTGCTGGATTAGTTCAGCAATAGTTCTC CTTCAAGCTGCTAAAATTAGATTTAAAGGTTTTCTTGCAGAAGCATGGGCTAAACTGTTG GGTGGAGATCCTACAGACTTTGTTGCCTGGTGTTATGCAAGTTGCAATGCTAAAGTAGGT GATTTTTCAGATGCTAATTGGCTTTTGGCCAATTTAGCAGAACATTTTGACGCAGATTAC ACAAATGCACTTCTTAAGAAGTGTGTGTCGTGCAATTGTGGTGTTAAGAGTTATGAACTT AGGGGTCTTGAAGCCTGTATTCAGCCAGTTCGAGCACCTAATCTTCTACATTTTAAAACG CAATATTCAAATTGCCCAACCTGTGGTGCAAGTAGTACGGATGAAGTAATAGAAGCTTCA TTACCGTACTTATTGCTTTTTGCTACTGATGGTCCTGCTACAGTTGATTGTGATGAAAA

[0103] TGGTCATTTAACCCAGAATCTAATGCCGTAGGTTCAATACTCCTAACTAATGGTCAACAA TGTAATTTTGCTATAGAGAGTGTGCCAATGGTGCTTTCTCCAATTATAAAGAATGGTGTT CTTTATTGTGAGGGTCAGTGGCTTGCTAAGTGTGAACCAGACCACTTGCCTAAAGATATA TTTGTTTGTACACCGGATAGACGTAATATCTACCGTATGGTGCAGAAATATACTGGTGAC CAAAGCGGAAATAAGAAACGGTTTGCTACGTTTGTCTATGCAAAGCAGTCAGTAGATACT GGCGAGCTAGAAAGTGTAGCAACAGGAGGGAGTAGTCTTTACACCTAAATGTGTGTGTGT AGAGAGTATTTAAAATTATTCTTTAATAGTGCCTCTATTTTAAGAGCGCATAATAGTATT ATTTTTGAGGATATTAATATAAATCCTCTCTGTTTTATACTCTCTTTTCAAGAGCTATTA TTTAAAAAACAGTTTTTCCACTCTTTTGTGCCAAAAACTATTGTTGTTAATGGTGTAACC TTTCAAGTAGATAATGGAAAAGTCTACTACGAAGGAAAACCAATTTTTCAGAAAGGTTGT TGTAGGTTGTGGTTGAGTTATAAAAAAGATTAAACTACCTACTACACTTATTTTTATAAG AGGCGTTTTATCTTACAAGCGCTTAATAAATACGGACGATGAAATGGCTGACTAGTTTTG TAAGGGCAGTTATTTCATGTTATAAACCCCTATTATTAACTCAATTAAGAGTATTAGATA GGTTAATCTTAGATCATGGACCAAAACACATCTTAACGTGTGTTAGGTGCGTGATTTTGT TTCAATTAGATTTAGTTTATAGGTTGGCGTATACGCCTACTCAATCGCTGGTATGAATAA TAGTAAAGATAATCCTTTTTGCGGAGCAATAGCAAGAAAAGCGCGAATTTATCTGAGAGA AGGATTAGATTGTGTTT ACTTTCTTAACAAAGCAGGACAAGCAGAGTCTTGTCCCGCGTG TACCTCTCTAGTATTCCAGGGGAAAACTTGTGAGGAACACAAATATAATAATAATCTTTT GTCATGGCAAGCGGTAAGGCAACTGGAAAGACAGATGCCCCAGCTCCAGTCATCAAACTA GGAGGACCAAAGCCACCTAAAGTTGGTTCTTCTGGAAATGTATCTTGGTTTCAAGCAATA AAAGCCAAGAAGTTAAATTCACCTCCGCCTAAGTTTGAAGGTAGCGGTGTTCCTGATAAT GAAAATCTAAAACCAAGTCAGCAGCATGGATATTGGAGACGCCAAGCTAGGTTTAAGCCA GGTAAAGGTGGAAGAAAACCAGTCCCAGATGCTTGGTATTTTTACTATACTGGAACAGGA CCAGCCGCTAACCTGAATTGGGGTGATAGCCAAGATGGTATAGTGTGGGTTGCTGGTAAG GGTGCTGATACTAAATTTAGATCTAATCAGGGTACTCGTGACTCTGACAAGTTTGACCAA TATCCGCTACGGTTTTCAGACGGAGGACCTGATGGTAATTTCCGTTGGGATTTCATTCCT CTGAATCGTGGCAGGAGTGGGAGATCAACAGCAGCTTCATCAGCAGCATCTAGTAGAGCA CCATCACGTGAAGTTTCGCGTGGTCGCAGGAGTGGTTCTGAAGATGATCTTATTGCTCGT GCAGCAAGGATAATTCAGGATCAGCAGAAGAAGGGTTCTCGCATTACAAAGGCTAAGGCT GATGAAATGGCTCACCGCCGGTATTGCAAGCGCACTATTCCACCTAATTATAAGGTTGAT CAAGTGTTTGGTCCCCGTACTAAAGGTAAGGAGGGAAATTTTGGTGATGACAAGATGAAT GAGGAAGGTATTAAGGATGGGCGCGTTACAGCAATGCTCAACCTAGTTCCTAGCAGCCAT GCTTGTCTTTTCGGAAGTAGAGTGACGCCCAGACTTCAACC AGATGGGCTGCACTTGAAA TTTGAATTTACTACTGTGGTCCCACGTGATGATCCGCAGTTTGATAATTATGTAAAAATT TGTGATCAGTGTGTTGATGGTGTAGGAACACGTCCAAAAGATGATGAACCAAGACCAAAG TCACGCTCAAGTTCAAGACCTGCAACAAGAGGAAATTCTCCAGCGCCAAGACAGCAGCGC CCTAAGAAGGAGAAAAAGCCAAAGAAGCAGGATGATGAAGTGGATAAAGCATTGACCTCA GATGAGGAGAGGAACAATGCACAGCTGGAATTTGATGATGAACCCAAGGTAATTAACTGG GGGGATTCAGCCCTAGGAGAGAATGAACTTTGAGTAAAATTCAATAGTAAGAGTTAAGGA AGATAGGCATGTAGCTTGATTACCTACATGTCTATCGCCAGGGAAATGTCTAATTTGTCT ACTTAGTAGCCTGGAAACGAACGGTAGACCCTTAGATTTTAATTTAGTTTAATTTTTAGT TTAGTTTAAGTTAGTTTAGAGTAGGTATAAAGATGCCAGTGCCGGGGCCACGCGGAGTAC GACCGAGGGTACAGCACTAGGACGCCCATTAGGGGAAGAGCTAAATTTTAGTTTAAGTTA AGTTTAATTGGCTATGTATAGTTAAAATTTATAGGCTAGTATAGAGTTAGAGCAAAAAAA AAAAAAAAAAAAAAAAAAAAAA

[104] RÉPLIQUE

[105] En plus des gènes structuraux et accessoires, les deux tiers d'un génome de coronavirus comprennent le gène de la réplicase (à l'extrémité 5 'du génome), qui est exprimé en deux polyprotéines, ppla et ppl ab, dans lesquelles pplab est un produit d'extension de ppla à la suite d'un mécanisme de décalage ribosomal -1. Les deux polyprotéines sont clivées par deux types de protéinases codées par virus, ce qui donne généralement 16 protéines non structurales (Nsp1 -16); IBV manque Nsp1 codant ainsi Nsp2-16.

[106] Ainsi, le gène 1 dans IBV code pour 15 (16 dans d'autres coronavirus) des protéines non structurales (nsp2-16), qui sont associées à la réplication et à la transcription de l'ARN.

[107] Le terme «protéine réplicase» est utilisé ici pour désigner les polyprotéines ppl a et pplab ou des sous-unités nsp individuelles. Le terme «gène de réplicase» est utilisé ici pour désigner une séquence d'acide nucléique qui code pour des protéines de réplicase.

[108] Un résumé des fonctions des protéines nsp du coronavirus est fourni dans le tableau 1.

[109]

[110] Le gène de réplicase variant codé par le coronavirus de la présente invention comprend une mutation dans une ou plusieurs des sections de séquence codant pour nsp-10, nsp-14, nsp-15 ou nsp-16.

[111] Nsp10 a une activité de liaison à l'ARN et semble être impliqué dans des interactions homo et / ou hétérotypiques au sein d'autres nsps de la région pp1a / pp1ab. Il adopte un pli α / β composé de cinq hélices a, une hélice 310 et trois brins β. Deux sites de liaison au zinc ont été identifiés qui sont formés par des résidus de cystéine conservés et un résidu d'histidine (Cys-74 / Cys-77 / His-83 / Cys-90; Cys-117 / Cys-120 / Cys-128 / Cys- 130). Il a été confirmé que la protéine se lie à l'ARN et à l'ADN simple brin et double brin sans spécificité évidente. Nsp-10 peut être réticulé avec nsp-9, suggérant l'existence d'un réseau complexe d'interactions protéine-protéine impliquant nsp-7, -8, -9 et -10. De plus, le nsp-10 est connu pour interagir avec le nsp-14 et le nsp-16.

[112] Nsp-14 comprend un domaine actif d'exoribonucléase 3 'à 5' (ExoN) dans la région amino-terminale. Il a été démontré que le SRS-CoV ExoN a une activité d'exoribonucléase 3 'à 5' dépendante des ions métalliques qui agit à la fois sur l'ARN simple brin et sur l'ARN double brin, mais pas sur l'ADN. Il a été démontré que le Nsp-14 a une activité de relecture. Il a également été démontré que cette nsp avait une activité N7-méthyltransférase (MT) dans la région carboxy-terminale. Une activité RNase associée à NendoU (endoribonucléase nidovirale, spécifique à U) a été signalée pour un certain nombre de coronavirus, y compris le SRAS-CoV, le MHV et l'IBV. Les activités ont été systématiquement signalées comme étant significativement améliorées par les ions Mn2 + et il y avait peu d'activité en présence de Mg2 + et de Ca2 +. NendoU se clive sur le côté 3 'des résidus d'uridylate dans l'ARN simple brin et double brin. Le ou les substrats biologiquement pertinents des coronavirus NendoU restent à identifier.

[113] Il a été prédit que Nsp-16 médie l'activité de la ribose-2'-0-méthyltransférase (2'-0-MTase) et des expériences de génétique inverse ont montré que le domaine 2'-0-MTase est essentiel pour la synthèse d'ARN viral dans HCoV-229E et SARS-CoV. L'enzyme peut être impliquée dans la production des structures cap 1 d'ARN de coronavirus et elle peut également coopérer avec NendoU et ExoN dans d'autres voies de traitement d'ARN. La 2'-0-MTase pourrait également méthyler des ARN spécifiques pour les protéger du clivage induit par NendoU. Les séquences génomiques et protéiques pour nsp-10, -14, -15 et -16 sont fournies comme SEQ ID NO: 2-5 et 6-9, respectivement.

[114] SEQ ID NO: 2 (séquence de nucleotides NSD-10 - nucleotides 1884-12318 1 de la SEQ ID NO: 1) TCTAi¾AGGTCATGAGACAGAGGAAGTGGATGCTGTAGGCATTCTCTCACTTTGTTCTTTTGCAGTA GATCCTGCGGATACATATTGTAAATATGTGGCAGCAGGTAATCAACCTTTAGGTAACTGTGTTAAA ATGTTGACAGTACATAATGGTAGTGGTTTTGCAATAACATCAAAGCCAAGTCCAACTCCGGATCAG GATTCTTATGGAGGAGCTTCTGTGTGTCTTTATTGTAGAGCACATATAGCACACCTTGGCGGAGCA GGAAATTTAGATGGACGCTGTCAATTTAAAGGTTCTTTTGTGCAAATACCTACTACGGAGAAAGAT CCTGTTGGATTCTGTCTACGTAACAAGGTTTGCACTGTTTGTCAGTGTTGGATTGGTTATGGATGT CAGTGTGATTCACTTAGACAACCTAAACCTTCTGTTCAG

[115] SEQ ID NO: 3 (nsp-14 séquence de nucleotides - nucleotides 16938-18500 de SEQ ID NO: 1) GGTACAGGCTTGTTTAAAATTTGCAACAAAGAGTTTAGTGGTGTTCACCCAGCTTATGCAGTCACA ACTAAGGCTCTTGCTGCAACTTATAAAGTTAATGATGAACTTGCTGCACTTGTTAACGTGGAAGCT GGTTCAGAAATAACATATAAACATCTTATTTCTTTGTTAGGGTTTAAGATGAGTGTTAATGTTGAA GGCTGCCACAACATGTTTATAACACGTGATGAGGCTATCCGCAACGTAAGAGGTTGGGTAGGTTTT GATGTAGAAGCAACACATGCTTGCGGTACTAACATTGGTACTAACCTGCCTTTCCAAGTAGGTTTC TCTACTGGTGCAGACTTTGTAGTTACGCCTGAGGGACTTGTAGATACTTCAATAGGCAATAATTTT GAGCCTGTGAATTCTAAAGCACCTCCAGGTGAACAATTTAATCACTTGAGAGCGTTATTCAAAAGT GCTAAACCTTGGCATGTTGTAAGGCCAAGGATTGTGCAAATGTTAGCGGATAACCTGTGCAACGTT TCAGATTGTGTAGTGTTTGTCACGTGGTGTCATGGCCTAGAACTAACCACTTTGCGCTATTTTGTT AAAATAGGCAAGGACCAAGTTTGTTCTTGCGGTTCTAGAGCAACAACTTTTAATTCTCATACTCAG GCTTATGCTTGTTGGAAGCATTGCTTGGGTTTTGATTTTGTTTATAATCCACTCTTAGTGGATATT CAACAGTGGGGTTATTCTGGTAACCTACAATTTAACCATGATTTGCATTGTAATGTGCATGGACAC GCACATGTAGCTTCTGCGGATGCTATTATGACGCGTTGTCTTGCAATTAATAATGCATTTTGTCAA GATGTCAACT

[116] SEQ ID NO: 4 (séquence de nucléotides nsp-15 - nucléotides 18501-19514 de SEQ ID NO: 1)

[117] TCTATCGACAATATTGCTTATAATATGTATAAGGGTGGTCATTATGATGCTATTGCAGGAGAAATG CCCACTATCGTAACTGGAGATAAAGTTTTTGTTATAGATCAAGGCGTAGAAAAAGCAGTTTTTTTT AATCAAACAATTCTGCCTACATCTGTAGCGTTTGAGCTGTATGCGAAGAGAAATATTCGCACACTG CCAAACAACCGTATTTTGAAAGGTTTGGGTGTAGATGTGACTAATGGATTTGTAATTTGGGATTAC ACGAACCAAACACCACTATACCGTAATACTGTTAAGGTATGTGCATATACAGACATAGAACCAAAT GGCCTAATAGTGCTGTATGATGATAGATATGGTGATTACCAGTCTTTTCTAGCTGCTGATAATGCT GTTTTAGTTTCTACACAGTGTTACAAGCGGTATTCGTATGTAGAAATACCGTCAAACCTGCTTGTT CAGAACGGTATTCCGTTAAAAGATGGAGCGAACCTGTATGTTTATAAGCGTGTTAATGGTGCGTTT GTTACGCTACCTAACACAATAAACACACAGGGTCGAAGTTATGAAACTTTTGAACCTCGTAGTGAT GTTGAGCGTGATTTTCTCGACATGTCTGAGGAGAGTTTTGTAGAAAAGTATGGTAAAGAATTAGGT CTACAGCACATACTGTATGGTGAAGTTGATAAGCCCCAATTAGGTGGTTTCCACACTGTTATAGGT ATGTGCAGACTTTTACGTGCGAATAAGTTGAACGCAAAGTCTGTTACTAATTCTGATTCTGATGTC ATGCAAAATTATTTTGTATTGGCAGACAATGGTTCCTACAAGCAAGTGTGTACTGTTGTGGATTTG CTGCTTGATGATTTCTTAGAACTTCTTAGGAACATACTGAAAGAGTATGGTACTAATAAGTCTAAA GTTGTAACAGTGTCAATTGATTACCATAGCATAAATTTTATGACTTGGTTTGAAGA TGGCATTATT AAAACATGTTATCCACAGCTTCAA

[118] SEQ ID NO: 5 (séquence de nucléotides nsp-16 - nucléotides 19515-20423 de SEQ ID NO: 1)

[119] TCAGCATGGACGTGTGGTTATAATATGCCTGAACTTTATAAAGTTCAGAATTGTGTTATGGAACCT TGCAACATTCCTAATTATGGTGTTGGAATAGCGTTGCCAAGTGGTATTATGATGAATGTGGCAAAG TATACACAACTCTGTCAATACCTTTCGAAAACAACAATGTGTGTACCGCATAATATGCGAGTAATG CATTTTGGAGCTGGAAGTGACAAAGGAGTGGTGCCAGGTAGTACTGTTCTTAAACAATGGCTCCCA GAAGGGACACTCCTTGTCGATAATGATATTGTAGACTATGTGTCTGATGCACATGTTTCTGTGCTT TCAGATTGCAATAAATATAAGACAGAGCACAAGTTTGATCTTGTGATATCTGATATGTATACAGAC AATGATTCAAAAAGAAAGCATGAAGGCGTGATAGCCAATAATGGCAATGATGACGTTTTCATATAT CTCTCAAGTTTTCTTCGTAATAATTTGGCTCTAGGTGGTAGTTTTGCTGTAAAAGTGACAGAGACA AGTTGGCACGAAGTTTTATATGACATTGCACAGGATTGTGCATGGTGGACAATGTTTTGTACAGCA GTGAATGCCTCTTCTTCAGAAGCATTCTTGATTGGTGTTAATTATTTGGGTGCAAGTGAAAAGGTT AAGGTTAGTGGAAAAACGCTGCACGCAAATTATATATTTTGGAGGAATTGTAATTATTTACAAACC TCTGCTTATAGTATATTTGACGTTGCTAAGTTTGATTTGAGATTGAAAGCAACGCCAGTTGTTAAT TTGAAAACTGAACAAAAGACAGACTTAGTCTTTAATTTAATTAAGTGTGGTAAGTTACTGGTAAGA GATGTTGGTAACACCTCTTTTACTAGTGACTCTTTTGTGTGTACTATGTAG

[120] SEQ ID NO: 6 (séquence d'acides aminés nsp-10)

[121] SKGHETEEVDAVGILSLCSFAVDPADTYCKYVAAGNQPLGNCVKMLTVHNGSGFAITSKPSPTPDQ DSYGGASVCLYCRAHIAHPGGAGNLDGRCQFKGSFVQIPTTEKDPVGFCLRNKVCTVCQCWIGQKDS

[122] SEQ ID NO: 7 (nsp-14 Séquence d'acides aminés) GTGL FKICNKE FSGVHPAYAVTTKALAATYKVNDELAALVNVEAGSE IT YKHL I SLLGFKMSVNVE GCHNMFITRDEAIRNVRGWVGFDVEATHACGTNIGTNLPFQVGFSTGADFWTPEGLVDTSIGNNF EPVNSKAPPGEQFNHLRALFKSAKPWHWRPRIVQMLADNLCNVSDCWFVTWCHGLELTTLRYFV KIGKDQVCSCGSRATTFNSHTQAYACWKHCLGFDFVYNPLLVDIQQWGYSGNLQFNHDLHCNVHGH AHVASADAIMTRCLAINNAFCQDVNWDLTYPHIANEDEVNSSCRYLQRMYLNACVDALKVNVVYDI GNPKGIKCVRRGDLNFRFYDKNPIVPNVKQFEYDYNQHKDKFADGLCMFWNCNVDCYPDNSLVCRY DTRNLSVFNLPGCNGGSLYVNKHAFHTPKFDRTSFRNLKAMPFFFYDSSPCETIQLDGVAQDLVSL AT KDC I T I KCN GGAVC KKHAQMY AD FVT S YNAAVT AG FT FWVTNNFNPYNLWKS FSALQ

[123] SEQ ID NO: 8 (séquence d'acides aminés nsp-15)

[124] SIDNIAYNMYKGGHYDAIAGEMPTIVTGDECVFVIDQGVEKAVFFNQTILPTSVAFELYAKRNIRTL PNNRILKGLGVDVTNGFVIWDYTNQTPLYRNTVKVCAYTDIEPNGLIVLYDDRYGDYQSFLAADNA VLVSTQCYKRYSYVEIPSNLLVQNGIPLKDGANLYVYKRVNGAFVTLPNTLNTQGRSYETFEPRSD VERDFLDMSEESFVEKYGKELGLQHILYGEVDKPQLGGLHTVIGMCRLLRANKLNAKSVTNSDSDV MQNYFVLADNGSYKQVCTWDLLLDDFLELLRNILKEYGTNKSKVVTVSIDYHSINFMTWFEDGII KTCYPQLQ SEQ ID NO: 9 (nsp-16 Séquence d'acides aminés)

[125] SAWTCGYNMPELYKVQNCVMEPCNIPNYGVGIALPSGIMMNVAKYTQLCQYLSKTTMCVPHNMRVM HFGAGSDKGVAPGSTVLKQWLPEGTLLVDNDIVDYVSDAHVSVLSDCNKYKTEHKFDLVISDMYTD NDSKRKHEGVIANNGNDDVFIYLSSFLRNNLALGGSFAViCVTETSWHEVLYDIAQDCAWWTMFCTA VNASSSEAFLVGVNYLGASEKVKVSGKTLHANYIFWRNCNYLQTSAYSIFDVAKFDLRLKATPWN LKTEQKTDLVFNLI KCGKLLVRDVGNTS FT SDS FVCTM.

[126] PATHOGÉNICITÉ RÉDUITE Le coronavirus vivant atténué de la présente invention comprend un gène de réplicase variant qui fait que le virus a une pathogénicité réduite par rapport à un coronavirus exprimant le gène de type sauvage correspondant.

[127] Le terme «atténué» tel qu'utilisé ici, fait référence à un virus qui présente ladite pathogénicité réduite et peut être classé comme non virulent. Un virus vivant atténué est un virus répliqué affaibli encore capable de stimuler une réponse immunitaire et de produire une immunité mais sans provoquer la maladie proprement dite.

[128] Le terme «pathogénicité» est utilisé ici selon sa signification normale pour désigner le potentiel du virus à provoquer une maladie chez un sujet. Typiquement, la pathogénicité d'un coronavirus est déterminée en testant les symptômes associés à la maladie, par exemple les éternuements, le snicking et la réduction de l'activité ciliaire trachéale. Le terme "pathogénicité réduite" est utilisé pour décrire que le niveau de pathogénicité d'un coronavirus est diminué, diminué ou diminué par rapport à un coronavirus de type sauvage correspondant.

Dans un mode de réalisation, le coronavirus de la présente invention a une pathogénicité réduite par rapport au virus parental M41-CK dont il est dérivé ou à un coronavirus témoin. Le coronavirus témoin peut être un coronavirus de pathogénicité connue, par exemple un coronavirus exprimant la protéine réplicase de type sauvage. La pathogénicité d'un coronavirus peut être évaluée en utilisant des méthodes bien connues dans l'art. En règle générale, la pathogénicité est évaluée en testant les symptômes cliniques chez un sujet atteint du virus, par exemple un poulet.

[129] À titre d'illustration, le poulet peut être testé à 8-24 jours par inoculation nasale ou oculaire. Les symptômes cliniques, associés à une infection par l'IBV, peuvent être évalués 3 à 10 jours après l'infection. Les symptômes cliniques couramment évalués pour déterminer la pathogénicité d'un coronavirus, par exemple un IBV, comprennent le halètement, la toux, les éternuements, le snicking, la dépression, les plumes ébouriffées et la perte d'activité ciliaire trachéale. La réplicase variante de la présente invention, lorsqu'elle est exprimée dans un coronavirus, peut provoquer un niveau réduit de symptômes cliniques par rapport à un coronavirus exprimant une réplicase de type sauvage.

[130] Par exemple, un coronavirus exprimant la réplique réplicase peut provoquer un nombre de snicks par oiseau par minute qui est inférieur à 90%, inférieur à 80%, inférieur à 70%, inférieur à 60%, inférieur à 50%, inférieur à 40%, moins de 30%, moins de 20% ou moins de 10% du nombre de snicks provoqués par un virus exprimant la réplicase de type sauvage.

[131] Un coronavirus exprimant une réplicase variant selon la présente invention peut provoquer une respiration sifflante en moins de 70%, moins de 60%, moins de 50%, moins de 40%, moins de 30%, moins de 20% ou moins de 10% du nombre d'oiseaux dans un troupeau infecté par le virus a exprimant la réplicase de type sauvage.

[132] Un coronavirus exprimant une réplicase variante selon la présente invention peut entraîner une activité ciliaire trachéale qui représente au moins 60%, au moins 70%, au moins 80%, au moins 90% ou au moins 95% du niveau de activité ciliaire trachéale chez les oiseaux non infectés.

Un coronavirus exprimant une réplicase variante selon la présente invention peut provoquer des symptômes cliniques, tels que définis dans le tableau 2, à un niveau inférieur à un coronavirus exprimant la réplicase de type sauvage.

[133]

[134] La réplicase variante de la présente invention, lorsqu'elle est exprimée dans un coronavirus, peut provoquer la réplication du virus à des niveaux non pathogènes in ovo.

[135] Lors du développement de vaccins à administrer in ovo à des embryons de poulet, il faut tenir compte de deux points: l'effet des anticorps maternels sur les vaccins et l'effet des vaccins sur l'embryon. Les anticorps maternels interfèrent avec l'immunisation active. Par exemple, les vaccins avec des souches légères n'induisent pas de niveaux d'anticorps protecteurs lorsqu'ils sont administrés à des poulets de chair avec des anticorps maternels car ces souches sont neutralisées par le pool d'anticorps maternels.

Ainsi, une particule virale doit être suffisamment efficace pour se répliquer et se propager pour garantir qu'elle n'est pas neutralisée par les anticorps d'origine maternelle contre le virus. Les anticorps maternels sont un pool fini d'anticorps efficaces, qui diminuent avec l'âge du poulet, et la neutralisation du virus de cette manière n'équivaut pas à l'établissement d'une immunité à long terme pour l'embryon / le poussin.

Afin de développer une immunité à long terme contre le virus, l'embryon et le poulet éclos doivent développer une réponse immunitaire protectrice appropriée qui est distincte de l'effet des anticorps d'origine maternelle. Pour être utile pour la vaccination in ovo, le virus ne doit pas non plus se répliquer et se propager à un niveau qui le rend pathogène pour l'embryon.


[136] Une pathogénicité réduite en termes d'embryon peut signifier que le coronavirus entraîne une réduction moindre de l'éclosion par rapport à un coronavirus témoin de type sauvage correspondant. Ainsi, le terme «sans être pathogène pour l'embryon» dans le contexte de la présente invention peut signifier «sans provoquer d'éclosion réduite» par rapport à un coronavirus témoin.

[137] Une réplicase variant appropriée peut être identifiée en utilisant des méthodes qui sont connues dans l'art. Par exemple, des expériences de provocation comparatives suivant la vaccination in ovo d'embryons avec ou sans anticorps dérivés de la mère peuvent être réalisées (c'est-à-dire dans lesquelles la couche a ou n'a pas été vaccinée contre IBV).

[138] Si la réplicase variante permet au virus de se propager à un niveau trop élevé, l'embryon n'éclosera pas ou ne sera pas viable après l'éclosion (c'est-à-dire que le virus est pathogène pour l'embryon). Un virus pathogène pour l'embryon peut tuer l'embryon.

[139] Si la réplicase variante entraîne une réduction de la réplication et de la propagation virales qui est trop importante, le virus sera neutralisé par les anticorps d'origine maternelle. Une provocation subséquente du poussin avec IBV entraînera donc le développement de symptômes cliniques (par exemple une respiration sifflante, un snicking, une perte d'activité ciliaire) et l'apparition d'une maladie chez le poussin contesté; car il n'aura pas réussi à développer une immunité efficace contre le virus.

VARIANT Tel qu'il est utilisé ici, le terme «variant» est synonyme de «mutant» et fait référence à une séquence d'acide nucléique ou d'acides aminés qui diffère par rapport à la séquence de type sauvage correspondante. Une séquence variant / mutante peut survenir naturellement ou peut être créée artificiellement (par exemple par mutagenèse dirigée).

Le mutant peut avoir au moins 70, 80, 90, 95, 98 ou 99% d'identité de séquence avec la partie correspondante de la séquence de type sauvage. Le mutant peut avoir moins de 20, 10, 5, 4, 3, 2 ou 1 mutation (s) sur la partie correspondante de la séquence de type sauvage.

[140] Le terme "type sauvage" est utilisé pour désigner un gène ou une protéine ayant une séquence de nucléotides ou d'acides aminés qui est identique respectivement au gène ou à la protéine native (c'est-à-dire le gène ou la protéine virale). Les comparaisons d'identité peuvent être effectuées à l'œil nu, ou plus généralement, à l'aide de programmes de comparaison de séquences facilement disponibles.

Ces programmes informatiques disponibles dans le commerce peuvent calculer le% d'identité entre deux séquences ou plus. Un programme informatique approprié pour effectuer un tel alignement est le package GCG Wisconsin Bestfit (Université du Wisconsin, États-Unis; Devereux et al., 1984, Nucleic Acids Research 12: 387).

Des exemples d'autres logiciels qui peuvent effectuer des comparaisons de séquences comprennent, sans s'y limiter, le package BLAST (voir Ausubel et al., 1999 ibid - Chapitre 18), FASTA (Atschul et al., 1990, J. Mol. Biol., 403-410) et la suite d'outils de comparaison GENEWORKS, ClustalX (voir Larkin et al. (2007) Clustal W et Clustal X version 2.0. Bioinformatics, 23: 2947-2948). BLAST et FASTA sont disponibles pour la recherche hors ligne et en ligne (voir Ausubel et al., 1999 ibid, pages 7-58 à 7-60).

Cependant, pour certaines applications, il est préférable d'utiliser le programme GCG Bestfit. Un nouvel outil, appelé BLAST 2 Sequences, est également disponible pour comparer les séquences de protéines et de nucléotides (voir FEMS Microbiol Lett 1999174 (2): 247-50; FEMS Microbiol Lett 1999177 (1): 187-8 et Cette adresse e-mail est protégée contre les robots spammeurs. Vous devez activer le JavaScript pour la visualiser. .nih.gov).

[141] La séquence peut avoir une ou plusieurs suppressions, insertions ou substitutions de résidus d'acides aminés qui produisent un changement silencieux et conduisent à une molécule fonctionnellement équivalente. Des substitutions délibérées d'acides aminés peuvent être effectuées sur la base d'une similitude de polarité, de charge, de solubilité, d'hydrophobicité, d'hydrophilie et / ou de la nature amphipathique des résidus tant que l'activité est conservée.

Par exemple, les acides aminés chargés négativement comprennent l'acide aspartique et l'acide glutamique; les acides aminés chargés positivement comprennent la lysine et l'arginine; et les acides aminés avec des groupes de têtes polaires non chargés ayant des valeurs d'hydrophilicité similaires comprennent la leucine, l'isoleucine, la valine, la glycine, l'alanine, l'asparagine, la glutamine, la sérine, la thréonine, la phénylalanine et la tyrosine.

[142] Des substitutions conservatrices peuvent être effectuées, par exemple selon le tableau ci-dessous, les acides aminés dans le même bloc dans la deuxième colonne et de préférence dans la même ligne dans la troisième colonne peuvent être substitués les uns aux autres:

[143]

[144] Le coronavirus de la présente invention peut comprendre un gène de réplicase variant qui code pour une protéine qui comprend une mutation par rapport à l'un quelconque de SEQ ID NO: 6, 7, 8 ou 9 qui, lorsqu'il est exprimé dans un coronavirus, provoque le virus avoir une pathogénicité réduite par rapport à un coronavirus exprimant la réplicase de type sauvage correspondante. Le gène de réplicase variant peut coder pour une protéine qui comprend au moins une ou plusieurs mutations d'acides aminés dans n'importe quelle combinaison de nsp-10, nsp-14, nsp-15 et nsp-16.

[145] Le gène de réplicase variant du coronavirus de la présente invention peut coder pour une protéine comprenant une mutation telle que définie dans les séquences mod M41 présentées sur la figure 10.

[146] Le gène de réplicase variant du coronavirus de la présente invention peut coder pour une protéine qui comprend une ou plusieurs mutations d'acides aminés sélectionnées dans la liste de:

[147] Pro à Leu en position 85 de SEQ ID NO: 6,

[148] Val à Leu en position 393 de SEQ ID NO: 7;

[149] Leu se trouvant à la position 183 de SEQ ID NO: 8;

[150] Val se trouvant à la position 209 de SEQ ID NO: 9. Le gène de réplicase variant du coronavirus de la présente invention peut coder pour une protéine qui ne comprend pas de mutation dans nsp-2, nsp-3, nsp-6 ou nsp-13.

[151] Le gène variant de la réplicase du coronavirus de la présente invention peut coder pour une protéine qui ne comprend pas une mutation dans nspl 0 qui correspond à la mutation thréonine à isoleucine provoquée par une mutation à la position nucléotidique 12 008 dans le gène rapporté par Ammayappan et al. . (Arch Virol (2009) 154: 495-499).

[152] Ammayappan et al (comme ci-dessus) rapporte l'identification de changements de séquence responsables de l'atténuation de la souche IBV Arkansas DPI. L'étude a identifié 17 changements d'acides aminés dans une variété de protéines IBV après plusieurs passages, env. 100, du virus dans les œufs embryonnés.

Il n'a pas été étudié si le virus atténué (Ark DP1 101) est capable de se répliquer en présence d'anticorps maternels contre le virus in ovo, sans être pathogène pour l'embryon. Étant donné que ce virus a été produit par plusieurs passages dans des œufs embryonnés SPF, méthodologie similaire pour les vaccins IBV classiques, il est probable que ce virus soit pathogène pour les embryons.

Le virus peut également être sensible aux anticorps d'origine maternelle si les poules ont été vaccinées avec un sérotype similaire. Le gène de réplicase variant du coronavirus de la présente invention peut coder pour une protéine qui comprend toute combinaison d'une ou plusieurs mutations d'acides aminés fournies dans la liste ci-dessus.

[153] Le gène variant de la réplicase peut coder une protéine qui comprend la mutation d'acide aminé Pro en Leu en position 85 de SEQ ID NO: 6.

[154] Le gène de la réplicase variant peut coder une protéine qui comprend la mutation des acides aminés Val en Leu à la position 393 de SEQ ID NO: 7. Le gène de la réplicase variante peut coder une protéine qui comprend la mutation des acides aminés Leu se situer à la position 183 de SEQ ID NO: 8.

[155] Le gène de la réplicase variante peut coder une protéine qui comprend la mutation d'acide aminé Val pour se trouver à la position 209 de SEQ ID NO: 9. Le gène de la réplicase variante peut coder une protéine qui comprend les mutations d'acide aminé Pro à Leu en position 85 de SEQ ID NO: 6, et Val à Leu en position 393 de SEQ ID NO: 7.

Le gène variant de la réplicase peut coder pour une protéine qui comprend les mutations d'acides aminés Pro en Leu en position 85 de SEQ ID NO: 6 Leu pour mentir en position 183 de SEQ ID NO: 8.

[156] Le gène de réplicase variant peut coder pour une protéine qui comprend les mutations d'acides aminés Pro en Leu en position 85 de SEQ ID NO: 6 et Val pour se trouver en position 209 de SEQ ID NO: 9.

[157] Le gène de réplicase variant peut coder pour une protéine qui comprend les mutations d'acides aminés Val en Leu en position 393 de SEQ ID NO: 7 et Leu pour se trouver en position 183 de SEQ ID NO: 8.

[158] Le gène de réplicase variant peut coder une protéine qui comprend les mutations d'acides aminés Val en Leu en position 393 de SEQ ID NO: 7 et Val se situer en position 209 de SEQ ID NO: 9.

[159] Le gène de la réplicase variant peut coder une protéine qui comprend les mutations d'acides aminés Leu pour se trouver à la position 183 de SEQ ID NO: 8 et Val à IIe à la position 209 de SEQ ID NO: 9. Le gène de la réplicase variante peut coder un protéine qui comprend les mutations d'acides aminés Pro en Leu en position 85 de SEQ ID NO: 6, Val en Leu en position 393 de SEQ ID NO: 7 et Leu en position 183 de SEQ ID NO: 8.

[160] Le gène variant de la réplicase peut coder pour une protéine qui comprend les mutations d'acides aminés Pro en Leu en position 85 de SEQ ID NO: 6 Leu pour se trouver en position 183 de SEQ ID NO: 8 et Val en mensonge en position 209 de SEQ ID NO: 9.

[161] Le gène variant de la réplicase peut coder pour une protéine qui comprend les mutations d'acides aminés Pro en Leu en position 85 de SEQ ID NO: 6, Val en Leu en position 393 de SEQ ID NO: 7 et Val en mensonge en position 209 de SEQ ID NO: 9. Le gène variant de la réplicase peut coder pour une protéine qui comprend les mutations d'acides aminés Val en Leu en position 393 de SEQ ID NO: 7, Leu en mensonge en position 183 de SEQ ID NO: 8 et Val en mensonge position 209 de SEQ ID NO: 9.

Le gène variant de la réplicase peut coder pour une protéine qui comprend les mutations d'acides aminés Pro en Leu en position 85 de SEQ ID NO: 6, Val en Leu en position 393 de SEQ ID NO: 7, Leu pour se situer à la position 183 de SEQ ID NO: 8 et Val pour se situer à la position 209 de SEQ ID NO: 9. Le gène de la réplicase variant peut également être défini au niveau nucléotidique.

[162] Par exemple, la séquence nucléotidique du gène de réplicase variant du coronavirus de la présente invention peut comprendre une ou plusieurs substitutions nucléotidiques dans les régions sélectionnées dans la liste de: 11884-12318, 16938-18500, 18501-19514 et 19515- 20423 de SEQ ID NO: 1.

[163] Par exemple, la séquence nucléotidique du gène de réplicase variant du coronavirus de la présente invention peut comprendre une ou plusieurs substitutions nucléotidiques choisies dans la liste de:

[164] C à T à la position nucléotidique 12137;

[165] G à C à la position nucléotidique 181 14;

[166] T à A à la position nucléotidique 19047; et

[167] G à A en position nucléotidique 20139;

[168] par rapport à la séquence représentée par SEQ ID NO: 1.

[169] Tel qu'utilisé ici, le terme "substitution" est synonyme du terme mutation et signifie que le nucléotide à la position identifiée diffère de celui de la séquence nucléotidique de type sauvage. La séquence nucléotidique peut comprendre toute combinaison des substitutions nucléotidiques choisie dans la liste de:

[170] C à T à la position nucléotidique 12137;

[171] G à C à la position nucléotidique 181 14;

[172] T à A à la position nucléotidique 19047; et

[173] G à A à la position nucléotidique 20139;

[174] par rapport à la séquence représentée par SEQ ID NO: 1. La séquence nucléotidique peut comprendre la substitution C12137T. La séquence nucléotidique peut comprendre la substitution G181 14C. La séquence nucléotidique peut comprendre la substitution T19047A. La séquence nucléotidique peut comprendre la substitution G20139A. La séquence nucléotidique peut comprendre les substitutions C12137T et G181 14C.

[175] La séquence nucléotidique peut comprendre les substitutions C12137T et T19047A. La séquence nucléotidique peut comprendre les substitutions C12137T et G20139A. La séquence nucléotidique peut comprendre les substitutions G18114C et T19047A. La séquence nucléotidique peut comprendre les substitutions G18114C et G20139A. La séquence nucléotidique peut comprendre les substitutions T19047A et G20139A.

[176] La séquence nucléotidique peut comprendre les substitutions C12137T, G181 14C et T19047A.

[177] La ​​séquence nucléotidique peut comprendre les substitutions C12137T, T19047A et G20139A.

[178] La séquence nucléotidique peut comprendre les substitutions C12137T, G181 14C et G20139A. La séquence nucléotidique peut comprendre les substitutions G18114C, T19047A et G20139A.

[179] La séquence nucléotidique peut comprendre les substitutions C12137T, G181 14C, T19047A et G20139A.

[180] La séquence nucléotidique peut ne pas comprendre une substitution qui correspond à la substitution C12008T rapportée par Ammayappan et al. (comme ci-dessus). La séquence nucléotidique peut être naturelle, synthétique ou recombinante. Il peut être double ou simple brin, il peut s'agir d'ADN ou d'ARN ou de leurs combinaisons. Il peut par exemple s'agir d'ADNc, de produit de PCR, de séquence génomique ou d'ARNm.

[181] La séquence nucléotidique peut être optimisée par un codon pour la production dans l'hôte / cellule hôte de choix.

[182] Il peut être isolé ou faire partie d'un plasmide, d'un virus ou d'une cellule hôte.

[183] ​​PLASMID

[184] Un plasmide est une molécule d'ADN extra-chromosomique distincte de l'ADN chromosomique qui est capable de se répliquer indépendamment de l'ADN chromosomique. Ils sont généralement circulaires et à double brin.

[185] Les plasmides, ou vecteurs (comme ils sont parfois connus), peuvent être utilisés pour exprimer une protéine dans une cellule hôte. Par exemple, une cellule hôte bactérienne peut être transfectée avec un plasmide capable de coder une protéine particulière, afin d'exprimer cette protéine. Le terme comprend également les chromosomes artificiels de levure et les chromosomes artificiels bactériens qui sont capables d'accueillir des portions plus longues d'ADN.

[186] Le plasmide de la présente invention comprend une séquence nucléotidique capable de coder une région définie de la protéine réplicase. Il peut également comprendre une ou plusieurs séquence (s) nucléotidique (s) de coronavirus supplémentaire (s), ou séquence (s) nucléotidique (s) capable de coder une ou plusieurs autres protéines de coronavirus telles que le gène S et / ou le gène 3.

[187] Le plasmide peut également comprendre un marqueur de résistance, tel que le gène de la guanine xanthine phosphoribosyltransférase (gpt) d'Escherichia coli, qui confère une résistance à l'acide mycophénolique (MPA) en présence de xanthine et d'hypoxanthine et est contrôlé par le virus de la vaccine P7 .5 promoteur précoce / tardif.

[188] VIRUS DE VACCINATION RECOMBINANT La présente invention concerne également un virus de la vaccine recombinant (rVV) comprenant un gène de réplicase variant tel que défini ici. Le virus de la vaccine recombinant (rVV) peut être fabriqué en utilisant un système de génétique inverse basé sur le virus de la vaccine.

[189] À cet égard, la présente invention propose également un procédé de fabrication d'une particule virale par:

[190] (i) transfecter un plasmide comme décrit dans la section précédente dans une cellule hôte;

[191] (ii) infecter la cellule hôte avec un virus recombinant comprenant le génome d'une souche de coronavirus avec un gène de réplicase;

[192] (iii) permettre à la recombinaison homologue de se produire entre les séquences du gène de réplicase dans le plasmide et les séquences correspondantes dans le génome du virus recombinant pour produire un gène de réplicase modifié;

[193] (iv) sélectionner pour recombiner un virus comprenant le gène de réplicase modifié.

[194] Le terme «gène de réplicase modifié» fait référence à un gène de réplicase qui comprend un gène de réplicase variant tel que décrit en relation avec le premier aspect de la présente invention. Plus précisément, le terme fait référence à un gène qui est dérivé d'un gène de réplicase de type sauvage mais comprend une séquence nucléotidique qui l'amène à coder pour une protéine réplicase variante telle que définie ici.

[195] La recombinaison peut impliquer tout ou partie du gène de la réplicase. Par exemple, la recombinaison peut impliquer une séquence nucléotidique codant pour n'importe quelle combinaison de nsp-10, nsp-14, nsp-15 et / ou nsp-16. La recombinaison peut impliquer une séquence nucléotidique qui code pour une mutation d'acides aminés ou comprend une substitution nucléotidique telle que définie ci-dessus.

Le génome de la souche de coronavirus peut manquer de la partie de la protéine réplicase correspondant à la partie fournie par le plasmide, de sorte qu'une protéine modifiée est formée par l'insertion de la séquence nucléotidique fournie par le plasmide.

[196] Le virus recombinant est un virus approprié pour permettre la recombinaison homologue entre son génome et le plasmide. Le virus de la vaccine convient particulièrement car la recombinaison homologue est couramment utilisée pour insérer et supprimer des séquences pour le génome du virus de la vaccine.

[197] La ​​méthode ci-dessus comprend facultativement l'étape:

[198] (v) récupération du coronavirus recombinant comprenant le gène de réplicase modifié à partir de l'ADN du virus recombinant de l'étape (iv). Des procédés de récupération de coronavirus recombinant, tels que l'IBV recombinant, sont connus dans l'art (voir Britton et al (2005) voir page 24; et PCT / GB2010 / 001293).

[199] Par exemple, l'ADN du virus recombinant de l'étape (iv) peut être inséré dans un plasmide et utilisé pour transfecter des cellules qui expriment l'ARN polymérase T7 cytoplasmique. Les cellules peuvent, par exemple, être pré-infectées avec un virus de la variole aviaire exprimant l'ARN polymérase T7.

Le coronavirus recombinant peut alors être isolé, par exemple, du milieu de croissance. Lorsque le plasmide est inséré dans le génome du virus de la vaccine, un intermédiaire instable se forme. Les recombinants comprenant le plasmide peuvent être sélectionnés pour par ex. en utilisant un marqueur de résistance sur le plasmide.

[200] Les recombinants positifs peuvent ensuite être vérifiés pour contenir le gène de réplicase modifié par, par exemple, par PCR et séquençage.

[201] D'importants stocks de virus recombinant, y compris le gène de la réplicase modifiée (par exemple le virus de la vaccine recombinant, (rVV) peuvent être élevés et l'ADN extrait afin de réaliser l'étape (v)).

[202] Des systèmes de génétique inverse appropriés sont connus dans l'art (Casais et al (2001) J. Virol 75: 12359-12369; Casais et al (2003) J. Virol. 77: 9084-9089; Britton et al (2005) J. Virological Methods 123: 203-211; Armesto et al (2008) Methods in Molecular Biology 454: 255-273).

[203] CELLULE

[204] Le coronavirus peut être utilisé pour infecter une cellule. Les particules de coronavirus peuvent être récoltées, par exemple à partir du surnageant, par des méthodes connues dans l'art, et éventuellement purifiées.

[205] La cellule peut être utilisée pour produire la particule de coronavirus. Ainsi, la présente invention propose également un procédé de production d'un coronavirus qui comprend les étapes suivantes:

[206] (i) infection d'une cellule par un coronavirus selon l'invention; (ii) permettre au virus de se répliquer dans la cellule; et

[207] (iii) la récolte du virus de la descendance.

[208] La présente invention propose également une cellule capable de produire un coronavirus selon l'invention en utilisant un système de génétique inverse. Par exemple, la cellule peut comprendre un génome de virus recombinant comprenant une séquence nucléotidique capable de coder le gène de la réplicase de la présente invention.

[209] La cellule peut être capable de produire un virus recombinant recombinant (par exemple le virus de la vaccine) contenant le gène de la réplicase.

[210] Alternativement, la cellule peut être capable de produire un coronavirus recombinant par un système de génétique inverse. La cellule peut exprimer ou être induite pour exprimer la polymérase T7 afin de sauver la particule virale recombinante.

[211] VACCIN

[212] Le coronavirus peut être utilisé pour produire un vaccin. Le vaccin peut par une forme atténuée vivante du coronavirus de la présente invention et peut en outre comprendre un support pharmaceutiquement acceptable. Tel que défini ici, les "supports pharmaceutiquement acceptables" appropriés pour une utilisation dans l'invention sont bien connus de l'homme du métier.

De tels supports comprennent, sans limitation, l'eau, une solution saline, une solution saline tamponnée, un tampon phosphate, des solutions alcool / aqueuses, des émulsions ou des suspensions. D'autres diluants et excipients conventionnellement employés peuvent être ajoutés conformément aux techniques classiques.

Ces supports peuvent comprendre de l'éthanol, des polyols et leurs mélanges appropriés, des huiles végétales et des esters organiques injectables. Des tampons et des agents d'ajustement du pH peuvent également être utilisés. Les tampons comprennent, sans limitation, des sels préparés à partir d'un acide ou d'une base organique.

Les tampons représentatifs comprennent, sans limitation, les sels d'acide organique, tels que les sels d'acide citrique, par exemple les citrates, l'acide ascorbique, l'acide gluconique, l'histidine-Hel, l'acide carbonique, l'acide tartrique, l'acide succinique, l'acide acétique ou l'acide phtalique, Tris, chlorhydrate de triméthanmine ou tampons de phosphate.

Les supports parentéraux peuvent comprendre une solution de chlorure de sodium, du dextrose de Ringer, du dextrose, du tréhalose, du saccharose et du chlorure de sodium, de la Ringer lactée ou des huiles fixes. Les supports intraveineux peuvent comprendre des reconstitutions de fluide et de nutriments, des régénérateurs d'électrolyte, tels que ceux à base de dextrose de Ringer et similaires.

Des conservateurs et autres additifs tels que, par exemple, des antimicrobiens, des antioxydants, des agents chélateurs (par exemple EDTA), des gaz inertes et similaires peuvent également être fournis dans les supports pharmaceutiques. La présente invention n'est pas limitée par la sélection du support.

La préparation de ces compositions pharmaceutiquement acceptables, à partir des composants décrits ci-dessus, ayant une isotonicité de pH, une stabilité et d'autres caractéristiques conventionnelles appropriées est à la portée de l'homme du métier. Voir, par exemple, des textes tels que Remington: The Science and Practice of Pharmacy, 20e éd., Lippincott Williams & Wilkins, pub!., 2000; et The Handbook of Pharmaceutical Excipients, 4ème édition, éd. R. C. Rowe et al, APhA Publications, 2003.

[213] Le vaccin de l'invention sera administré en une "quantité thérapeutiquement efficace", qui se réfère à une quantité d'un ingrédient actif, par exemple, un agent selon l'invention, suffisante pour obtenir des résultats bénéfiques ou souhaités lorsqu'il est administré à un sujet ou patient.

Une quantité efficace peut être administrée en une ou plusieurs administrations, applications ou dosages. Une quantité thérapeutiquement efficace d'une composition selon l'invention peut être facilement déterminée par l'homme du métier. Dans le contexte de la présente invention, une "quantité thérapeutiquement efficace" est une quantité qui produit un changement mesuré objectivement dans un ou plusieurs paramètres associés à un état de bronchite infectieuse suffisant pour obtenir des résultats bénéfiques ou souhaités.

Une quantité efficace peut être administrée en une ou plusieurs administrations. Aux fins de la présente invention, une quantité efficace de médicament, de composé ou de composition pharmaceutique est une quantité suffisante pour réduire l'incidence de la bronchite infectieuse.

Tel qu'il est utilisé ici, le terme "thérapeutique" englobe le spectre complet des traitements pour une maladie, un état ou un trouble. Un agent "thérapeutique" de l'invention peut agir de manière prophylactique ou préventive, y compris celles qui intègrent des procédures conçues pour cibler des animaux pouvant être identifiés comme étant à risque (pharmacogénétique); ou d'une manière qui soit de nature amélioratrice ou curative; ou peut agir pour ralentir la vitesse ou l'étendue de la progression d'au moins un symptôme d'une maladie ou d'un trouble traité.

[214] La présente invention concerne également un procédé de production d'un tel vaccin qui comprend l'étape d'infecter des cellules, par exemple des cellules Vero, avec une particule virale comprenant une protéine réplicase telle que définie en relation avec le premier aspect de l'invention.

[215] MÉTHODE DE VACCINATION Le coronavirus de la présente invention peut être utilisé pour traiter et / ou prévenir une maladie. «Traiter» signifie administrer le vaccin à un sujet ayant une maladie existante afin d'atténuer, de réduire ou d'améliorer au moins un symptôme associé à la maladie et / ou de ralentir, réduire ou bloquer la progression de la maladie.

"Prévenir" signifie administrer le vaccin à un sujet qui n'a pas encore contracté la maladie et / ou qui ne présente aucun symptôme de la maladie pour prévenir ou altérer la cause de la maladie (par exemple une infection) ou pour réduire ou prévenir le développement d'au moins un symptôme associé à la maladie. La maladie peut être toute maladie causée par un coronavirus, telle qu'une maladie respiratoire et / ou une gastro-entérite chez l'homme et une hépatite, une gastro-entérite, une encéphalite ou une maladie respiratoire chez d'autres animaux.

[216] La maladie peut être une bronchite infectieuse (IB); Diarrhée épidémique porcine; Gastro-entérite transmissible; Virus de l'hépatite de souris; Encéphalomyélite hémagglutinante porcine; Syndrome respiratoire aigu sévère (SRAS); ou maladie Bluecomb.

[217] La ​​maladie peut être une bronchite infectieuse. Le vaccin peut être administré à des poussins éclos ou à des poulets, par exemple par collyre ou par administration intranasale. Bien que précises, ces méthodes peuvent être coûteuses, par exemple pour les grands troupeaux de poulets de chair.

Les alternatives incluent l'inoculation par pulvérisation de l'administration à l'eau potable, mais il peut être difficile d'assurer une application uniforme du vaccin en utilisant de telles méthodes. Le vaccin peut être fourni sous une forme appropriée pour son administration, comme un compte-gouttes pour une utilisation intra-oculaire.

[218] Le vaccin peut être administré par inoculation in ovo, par exemple par injection d'œufs embryonnés. La vaccination in ovo a l'avantage de fournir une résistance précoce à la maladie. Il facilite également l'administration d'une dose uniforme par sujet, contrairement à l'inoculation par pulvérisation et à l'administration via l'eau potable.

[219] Le vaccin peut être administré dans n'importe quel compartiment approprié de l'œuf, y compris le liquide allantoïdien, le sac vitellin, l'amnios, la cellule d'air ou l'embryon. Il peut être administré sous la membrane de la coquille (cellule à air) et la membrane chorioallantoïque. Habituellement, le vaccin est injecté dans des œufs embryonnés au cours des derniers stades du développement embryonnaire, généralement pendant le dernier quart de la période d'incubation, par exemple 3 à 4 jours avant l'éclosion. Chez les poulets, le vaccin peut être administré entre le 15e et le 19e jour de la période d'incubation de 21 jours, par exemple au 17e ou au 18e jour.

[220] Le processus peut être automatisé en utilisant un processus d'injection robotique, tel que ceux décrits dans WO 2004/078203.

[221] Le vaccin peut être administré avec un ou plusieurs autres vaccins, par exemple, des vaccins pour d'autres maladies, comme le virus de la maladie de Newcastle (NDV). La présente invention propose également une composition vaccinale comprenant un vaccin selon l'invention conjointement avec un ou plusieurs autres vaccins. La présente invention propose également un kit comprenant un vaccin selon l'invention conjointement avec un ou plusieurs autres vaccins pour une administration séparée, séquentielle ou simultanée.

[222] Le vaccin ou la composition du vaccin.

[223] La composition peut éventuellement comprendre un support, diluant, excipient ou adjuvant pharmaceutiquement acceptable. Le choix du support pharmaceutique, de l'excipient ou du diluant peut être choisi en fonction de la voie d'administration prévue et de la pratique pharmaceutique standard.

Les compositions pharmaceutiques peuvent comprendre en tant que (ou en plus) le support, l'excipient ou le diluant, tout liant (s) approprié (s), lubrifiant (s), agent (s) de suspension, agent (s) de revêtement, agent (s) de solubilisation, et d'autres agents porteurs qui peuvent aider ou augmenter la délivrance ou l'immunogénicité du virus.

[224] L'invention va maintenant être décrite plus en détail à l'aide d'exemples, qui sont destinés à servir à l'homme du métier ordinaire dans la mise en œuvre de l'invention et ne sont en aucun cas destinés à limiter la portée de l'invention.

[225] EXEMPLES EXEMPLE 1 - Génération d'un système de génétique inverse IBV basé sur M41 -CK

[226] Un ADNc de pleine longueur M41-CK a été produit en remplaçant l'ADNc de Beaudette dans le système de génétique inverse du virus Vaccinia précédemment décrit dans PCT / GB2010 / 001293 (incorporé ici par référence) avec de l'ADNc synthétique dérivé de la séquence consensus M41.

[227] L'ADNc d'IBV dans la structure du virus de la Vaccinie recombinant (rVV) rVV-BeauR-Rep-M41 décrit dans Armesto, Cavanagh et Britton (2009). PLoS ONE 4 (10): e7384. doi: 10.1371 / journal.pone.0007384, qui se composait de la réplicase dérivée de la souche IBV Beaudette et des gènes structurels et accessoires et 3 'UTR d'IBV M41 -CK, a été encore modifiée par le remplacement de la Beaudette 5' UTR-Nsp2- Séquence Nsp3 avec la séquence correspondante de IBV M41 -CK. L'ADNc d'IBV résultant consistait en 5 'UTR-Nsp2-Nsp3 de M41, Nsp4-Nsp16 de Beaudette et les gènes structuraux et accessoires et 3' UTR de M41. Cet ADNc a été encore modifié par la suppression de la séquence Beaudette Nsp4-Nsp16.

L'ADNc résultant, dépourvu de Nsp4-16, a été modifié en quatre étapes supplémentaires au cours desquelles les Nsps supprimés ont été successivement remplacés par les séquences correspondantes de M41 -CK, les ADNc de remplacement représentés M41 - CK Nsp4-8, Nsp9-12, Nsp12-14 et enfin Nsp15-16. Chaque ADNc de remplacement contenait env. 500 nucléotides à l'extrémité 5 'correspondant à la séquence 3' la plus M41 précédemment insérée et env.

500 nucléotides à l'extrémité 3 'correspondant à la séquence du gène M41 S. Cela a permis l'insertion de la séquence d'ADNc M41 par recombinaison homologue et addition séquentielle de la séquence du gène de la réplicase M41 contiguë. Les ADNc synthétiques contenant les séquences Nsp dérivées de M41 ont été ajoutés par recombinaison homologue en utilisant le système de sélection dominante transitoire (TDS) décrit précédemment par l'inventeur (voir PCT / GB2010 / 001293). Les ADNc dérivés de M41 contenant la séquence correspondant aux M41 Nsps-10, -14, -15 et -16 contenaient les acides aminés modifiés aux positions 85, 393, 183 et 209, respectivement, comme indiqué sur la figure 10.

[228] Un ADNc de pleine longueur représentant le génome de M41 -CK a été généré dans le virus Vaccinia représentant les séquences synthétiques. Deux rIBV, M41 -R-6 et M41 -R-12, ont été sauvés et se sont révélés croître d'une manière similaire à M41 -CK (Fig. 1).

[229] EXEMPLE 2 - Détermination de la pathogénicité des virus M41 sauvés

[230] Les virus sauvés dans l'exemple 1 ont été utilisés pour infecter un agent pathogène spécifique âgé de 8 jours sans

[231] (SPF) poussins par inoculation oculaire et nasale pour tester leur pathogénicité, comme en témoignent les signes cliniques quotidiennement 3-7 jours après l'infection et pour l'activité ciliaire les jours 4 et 6 après l'infection. La perte d'activité ciliaire est une méthode bien établie pour déterminer la pathogénicité de l'IBV.

Les deux virus M41 -R se sont révélés apathogènes par rapport à M41-CK, bien qu'ils aient montré certains signes cliniques par rapport aux poussins témoins non infectés (Fig.2) et une perte mais incohérente de l'activité ciliaire (Fig.3).

[232] Ainsi, les clones moléculaires M41 -R de M41 -CK n'étaient pas pathogènes par rapport au virus parental M41 -CK. Les inventeurs ont identifié plusieurs différences nucléotidiques dans le M41 -R par rapport aux séquences M41 -CK. La majorité d'entre elles étaient des mutations synonymes, car le changement de nucléotide n'a pas affecté la séquence d'acides aminés de la protéine associée à la séquence. Cependant, quatre mutations non synonymes ont été identifiées dans le gène de la réplicase IBV spécifique aux composants Nsp-10, Nsp-14, Nsp-15 et Nsp-16 du gène de la réplicase, ces mutations ont entraîné des changements d'acides aminés (tableau 3).

[233] Tableau 3. Mutations non Svnonvmous identifiées dans la NSDS du génome M41-R à pleine longueur

[234]

[235] EXEMPLE 3 - Réparation de rIBV M41 -R

[236] Afin de déterminer si les mutations identifiées étaient responsables de la perte de pathogénicité associée à M41 -R, la mutation Nsp10 a été réparée et les mutations dans Nsp-14, -15 et -16 ont été réparées et ont montré leur croissance dans un manière similaire à M41 -CK (Fig 9).

 

Les inventeurs ont ainsi généré les rIBV, M41 R-nsp10rep et M41 R-nsp14, 15, 16rep, en utilisant des ADNc synthétiques contenant les bons nucléotides en utilisant le système décrit précédemment (TDS) de l'inventeur (voir PCT / GB2010 / 001293). La pathogénicité des poussins a été évaluée chez les poussins comme décrit précédemment. Les deux rIBV ont montré une pathogénicité accrue par rapport à M41 -R mais pas au niveau observé avec M41 -CK (figures 4 et 5). M41 R-nsp14, 15, 16rep a donné plus de signes cliniques et de réduction de l'activité ciliaire que M41 R-nsp10rep, dans l'ensemble, ces résultats ont indiqué que les changements associés aux quatre Nsps semblent affecter la pathogénicité.

[237] Pour déterminer les rôles des Nsps dans la pathogénicité, l'ADNc de pleine longueur correspondant au M41 R-nsp10rep a été utilisé pour réparer les mutations dans Nsps14, 15 et 16 en utilisant un ADNc synthétique contenant les nucléotides corrects utilisant le système TDS.

[238] Les rIBV suivants ont été produits: -

[239] M41 R-nsp10, 15rep - M41-R avec les mutations dans Nsp-10 et Nsp-15 réparées

[240] M41 R-nsp10, 14, 15rep - M41-R avec des mutations dans Nsp-10, -14 et -15 réparées

[241] M41 R-nsp10, 14, 16rep - M41-R avec des mutations dans Nsp-10, -14 et -16 réparées

[242] M41 R-nsp10, 15, 16rep - M41 -R avec des mutations dans Nsp-10, -15 et -16 réparées

[243] M41-K - Les quatre mutations, Nsp-10, -14, -15 et -16 réparées dans M41 -R

[244] Il a été démontré que les rIBV croissent d'une manière similaire à M41 -CK (figure 9) et leur pathogénicité a été évaluée comme décrit précédemment. M41 -K (dans lequel les quatre mutations ont été réparées) a entraîné des signes cliniques et une perte de 100% de l'activité ciliaire (ciliostase complète) 4 jours après l'infection (Fig. 6, 7 & 8).

Les autres rIBV ont démontré des niveaux variables de pathogénicité, à l'exception du M41 R-nsp10, 15, 16rep, qui était essentiellement apathogène. Ces résultats ont confirmé que la réparation des quatre Nsps a rétabli la pathogénicité de M41 -R; soutenant à nouveau la preuve précédente que les mutations décrites dans les quatre Nsps sont impliquées dans l'atténuation de M41-CK.

[245] Les inventeurs ont également généré rIBV M41 R-nsp 10, 14 rep (nsp 10 et 14 sont réparés, nsp 15 et 16 contiennent des mutations) et rIBV M41 R-nsp 10, 16 rep (nsp 10 et 16 sont réparés, nsp 14 et 15 contiennent des mutations) et évalué la pathogénicité de ces virus. rIBV M41 R-nsp 10, 14 rep moins pathogène que M41-K mais a provoqué environ 50% de ciliostase les jours 4 à 6 après l'infection. Le rIBV M41 R-nsp 10, 16 rep était presque apathogène et ne provoquait aucune ciliostase (voir figure 11 a-c). Ainsi, le génome associé à M41-R est un génome de squelette potentiel pour un IBV rationnellement atténué. EXEMPLE 4 - Étude de vaccination / challenge avec M41 -R

[246] Les virus vaccinaux candidats ont été testés dans des études dans lesquelles des œufs de poule fécondés ont été vaccinés in ovo à 18 jours d’embryonation et dans lesquels l’éclosion des œufs inoculés a été déterminée. La santé clinique des poulets a été étudiée et les poulets ont été testés à 21 jours avec un virus de provocation IB M41 virulent à 103,65 EID50 par dose.

[247] Les signes cliniques ont été étudiés après la protection par provocation par le vaccin et un test de ciliostase a été effectué 5 jours après la provocation pour étudier l'effet des virus de provocation sur le mouvement des cils et la protection par le vaccin contre la ciliostase (inhibition du mouvement des cils) .

[248] Vaccination in ovo dans les œufs de poulets de chair commerciaux La conception de l'expérience est donnée dans le tableau 4 et les résultats cliniques sont présentés dans le tableau 5. L'éclosion des œufs inoculés avec IB M41 -R était bonne et les poulets étaient en bonne santé. IB M41-R protégé contre les signes cliniques après provocation chez les poulets de chair (placebo: 19/19 affecté, IB M41 -R: 3/18 affecté et 1 mort). Les résultats du test de ciliostase sont donnés dans le tableau 6. IB M41-R a généré une protection contre la ciliostase.

[249] Tableau 4 - Conception d'une étude d'éclosion, d'innocuité et d'efficacité dans des œufs commerciaux

[250]

[251] 1 Volume de dose 0,1 ml, NA, sans objet.

[252] 2 103,65 EID50 par dose.

[253] Tableau 5 - Pourcentages d'éclosion et données cliniques avant et après épreuve chez les poulets commerciaux, pour la conception, voir le tableau 1.

[254]

[255] 1 Système respiratoire perturbé

[256] 2 Whizzing

[257] 3 Changement de voix

[258] 4 Respiration difficile

[259] 5 sinus intra-orbitaux enflés

[260] 6 Croissance inégale

[261] 7 Faible

[262] Tableau 6 - Résultats du test de ciliostase après épreuve pour la desin voir tableau 1.

[263]
Vaccination in ovo dans des œufs spécifiques sans pathogènes (SPF)

[264] La conception de l'étude sur les œufs SPF est donnée dans le tableau 7 et est similaire à la conception des études avec des poulets de chair commerciaux, mais la dose de vaccination pour IB M41 -R était plus élevée (105 EID50 par dose).

[265] Les résultats (tableau 8) montrent que le pourcentage d'éclosion pour l'éclosion IB M41 -R était faible, et 19 des 40 éclos et les poussins étaient faibles. Huit poussins sont morts. Les 1 1 poulets restants ont été testés et 1 1 des poussins éclos des œufs qui avaient été inoculés avec une solution saline ont été testés.

[266] Dans le test de ciliostase après épreuve, il est apparu que tous les poulets vaccinés in ovo avec IB M41-R étaient protégés, alors qu'aucun des témoins n'était protégé, voir Tableau 9. Tableau 7. Conception d'un hatchabilitv. étuded'innocuité et d'efficacité sur les œufs SPF

[267]

[268] Volume de dose 0,1 ml, NA, sans objet.

[269] 2 Dose d'épreuve 1033 EID50 dans 0,2 ml.

[270] Tableau 8. Pourcentages d'éclosion et données cliniques avant et après épreuve chez les poulets SPF, pour la conception, voir le tableau 7.

[271]

[272] Tableau 9. Résultats du test de ciliostase après épreuve, pour la conception, voir le tableau 7.

[273] En conclusion, IB M41 -R était sans danger dans les œufs commerciaux, a généré une protection contre les signes cliniques et dans une certaine mesure contre la ciliostase.

[274] Dans les œufs SPF vaccinés avec IB M41 R, un nombre relativement faible de poulets a éclos. Cela peut être dû aux 10 s EID50 par œuf d'IB M41 -R utilisé. Cela était 10 fois plus élevé que la dose utilisée dans des études antérieures dans lesquelles il y avait un niveau d'éclosion plus élevé.

Les pourcentages d'éclosion plus faibles peuvent également être causés par une sensibilité particulièrement élevée du lot d'œufs SPF aux virus, car dans d'autres études, le niveau de mortalité embryonnaire était également plus élevé que celui précédemment observé.

[275] Après l'épreuve, tous les poulets survivants après l'éclosion étaient complètement protégés contre la ciliostase. Il est conclu que IB M41 -R a un grand potentiel en tant que vaccin à administrer in ovo. Toutes les publications mentionnées dans la spécification ci-dessus sont incorporées ici par référence.

Diverses modifications et variations des procédés et du système décrits de l'invention apparaîtront à l'homme du métier sans s'écarter de la portée et de l'esprit de l'invention. Bien que l'invention ait été décrite en relation avec des modes de réalisation préférés spécifiques, il doit être entendu que l'invention telle que revendiquée ne doit pas être indûment limitée à ces modes de réalisation spécifiques.

En effet, diverses modifications des modes décrits pour la mise en oeuvre de l'invention qui sont évidentes pour l'homme du métier en biologie moléculaire, virologie ou domaines apparentés sont destinées à entrer dans le cadre des revendications suivantes.


 

RÉCLAMATIONS

1. Coronavirus vivant atténué comprenant un gène de réplicase variant codant pour des polyprotéines comprenant une mutation dans une ou plusieurs des protéines non structurales (nsp) -10, nsp-14, nsp-15 ou nsp-16.

2. Coronavirus selon la revendication 1, dans lequel le gène variant de la réplicase code pour une protéine comprenant une ou plusieurs mutations d'acides aminés sélectionnées dans la liste de:

Pro à Leu en position 85 de SEQ ID NO: 6,

Val à Leu en position 393 de SEQ ID NO: 7;

Leu se trouve à la position 183 de SEQ ID NO: 8;

Val se trouve à la position 209 de SEQ ID NO: 9.

3. Coronavirus selon la revendication 1 ou 2, dans lequel le gène de la réplicase code pour une protéine comprenant la mutation en acides aminés Pro en Leu en position 85 de SEQ ID NO: 6.

4. Coronavirus selon l'une quelconque des revendications précédentes, dans lequel le gène de la réplicase code pour une protéine comprenant les mutations d'acides aminés Val en Leu en position 393 de SEQ ID NO: 7; Leu se trouve à la position 183 de SEQ ID NO: 8; et Val se trouve à la position 209 de SEQ ID NO: 9.

5. Coronavirus selon l'une quelconque des revendications précédentes, dans lequel le gène de la réplicase code pour une protéine comprenant les mutations d'acides aminés Pro en Leu en position 85 de SEQ ID NO: 6; Val à Leu en position 393 de SEQ ID NO: 7; Leu se trouve à la position 183 de SEQ ID NO: 8; et Val se trouve à la position 209 de SEQ ID NO: 9.

6. Coronavirus selon l'une quelconque des revendications précédentes, dans lequel le gène de la réplicase comprend une ou plusieurs substitutions nucléotidiques sélectionnées dans la liste de:

C à T à la position nucléotidique 12137;

G à C à la position nucléotidique 181 14;

T à A à la position nucléotidique 19047; et

G à A à la position nucléotidique 20139;

par rapport à la séquence représentée par SEQ ID NO: 1. 7. Coronavirus selon l'une quelconque des revendications précédentes qui est un virus de la bronchite infectieuse (IBV).

8. Coronavirus selon l'une quelconque des revendications précédentes qui est IBV M41.

9. Coronavirus selon la revendication 8, qui comprend au moins une protéine S, dont une partie provient d'un sérotype IBV autre que M41. 10. Coronavirus selon la revendication 9, dans lequel la sous-unité S1 provient d'un sérotype IBV autre que M41.

1 1. Coronavirus selon la revendication 9, dans lequel la protéine S provient d'un sérotype IBV autre que M41.

12. Coronavirus selon l'une quelconque des revendications précédentes, qui a réduit

pathogénicité par rapport à un coronavirus exprimant une réplicase de type sauvage correspondante, de sorte que lorsque le virus est administré à un œuf embryonné, il est capable de se répliquer sans être pathogène pour l'embryon.

13. Gène variant de réplicase tel que défini dans l'une quelconque des revendications 1 à 6.

14. Protéine codée par un gène de réplicase de coronavirus variant selon la revendication 13. 15. Plasmide comprenant un gène de réplicase selon la revendication 13.

16. Procédé de fabrication du coronavirus selon l'une quelconque des revendications 1 à 12 qui comprend les étapes suivantes:

(i) transfecter un plasmide selon la revendication 15 dans une cellule hôte;

(ii) infecter la cellule hôte avec un virus recombinant comprenant le génome d'une souche de coronavirus avec un gène de réplicase;

(iii) permettre à la recombinaison homologue de se produire entre les séquences du gène de réplicase dans le plasmide et les séquences correspondantes dans le génome du virus recombinant pour produire un gène de réplicase modifié; et

(iv) sélectionner pour recombiner un virus comprenant le gène de réplicase modifié.

17. Procédé selon la revendication 16, dans lequel le virus recombinant est un virus de la vaccine. 18. Procédé selon la revendication 16 ou 17 qui comprend également l'étape:

(v) récupérer le coronavirus recombinant comprenant le gène de réplicase modifié à partir de l'ADN du virus recombinant de l'étape (iv).

19. Cellule capable de produire un coronavirus selon l'une quelconque des revendications 1 à 12.

20. Vaccin comprenant un coronavirus selon l'une quelconque des revendications 1 à 12 et un support pharmaceutiquement acceptable.

21. Procédé de traitement et / ou de prévention d'une maladie chez un sujet qui comprend l'étape d'administration d'un vaccin selon la revendication 20 au sujet. 22. Vaccin selon la revendication 20, destiné à être utilisé dans le traitement et / ou la prévention d'une maladie chez un sujet.

23. Utilisation d'un coronavirus selon l'une quelconque des revendications 1 à 12 dans la fabrication d'un vaccin pour traiter et / ou prévenir une maladie chez un sujet.

24. Procédé, vaccin ou utilisation selon la revendication 21, 22 ou 23, dans lequel la maladie est la bronchite infectieuse (IB).

25. Procédé selon la revendication 21, dans lequel le mode d'administration est choisi dans le groupe constitué de; administration de collyre, administration intranasale, administration d'eau potable, injection post-éclosion et injection in ovo.

26. Procédé selon la revendication 24, dans lequel la vaccination est une vaccination in ovo. 27. Procédé de production d'un vaccin selon la revendication 20, qui comprend l'étape d'infecter une cellule selon la revendication 19 avec un coronavirus selon l'une quelconque des revendications 1.


Ajouter un Commentaire

Attention, si vous voulez laisser un message personnel à LesManchettes.com vous devez, soit le faire par la page Accueil / "nous joindre" ou laisser votre adresse de courriel dans le champ du formulaire commentaire (Adresse email) pour une réponse.


Code de sécurité
Rafraîchir

Encore une fois les médias traditionnels se trompent - TVA - Radio-Canada - La Presse - Le Devoir - Le Soleil

Encore une fois les médias traditionnels se trompent - TVA - Radio-Canada - La Presse - Le Devoir - Le Soleil

Au royaume de Big Médias,  le journalisme est mort!

Au royaume de Big Médias, le journalisme est mort!

Emmanuelle Latraverse suspend son compte parce que Facebook ne censure pas le Président Trump..

Qui n'aurait pas tomber dans le panneau ? - Kariane Bourassa TVA Nouvelles

Qui n'aurait pas tomber dans le panneau ? - Kariane Bourassa TVA Nouvelles

Quand les médias tentent de faire changer l'opinion publique

Quand les médias tentent de faire changer l'opinion publique

Élisabeth Massicolli journaliste pour le magazine Clin D'oeil déferle sa haine sur Facebook

Élisabeth Massicolli journaliste pour le magazine Clin D'oeil déferle sa haine sur Facebook

La Presse demande l'aide au gouvernement du Québec, faites-moi rire!

La Presse demande l'aide au gouvernement du Québec, faites-moi rire!

La soirée est encore jeune de Radio-Canada - Xavier Camus

La soirée est encore jeune de Radio-Canada - Xavier Camus

Soleimani était un meurtrier, son chef" est aussi un meurtrier! »

Soleimani était un meurtrier, son chef" est aussi un meurtrier! »

Gros pervers à la Joe Biden

Gros pervers à la Joe Biden

Il faut lire La Presse ces jours-ci pour voir à quoi ressemble une entreprise de propagande maquillée en grand reportage.

Il faut lire La Presse ces jours-ci pour voir à quoi ressemble une entreprise de propagande maquillée en grand reportage.

Radio-Canada fait face à des plaintes de groupes de travailleurs migrants accusés de racisme et de préjudice aux migrants

Radio-Canada fait face à des plaintes de groupes de travailleurs migrants accusés de racisme et de préjudice aux migrants

Un journaliste de VICE EXPOSÉ en tant que leader de l'Antifa britannique

Un journaliste de VICE EXPOSÉ en tant que leader de l'Antifa britannique

CBC retire un article anti-Israël sur COVID-19 après une plainte de Honest Reporting Canada

CBC retire un article anti-Israël sur COVID-19 après une plainte de Honest Reporting Canada

Petit rappel au diffuseur de médias Radio-Canada, il semble avoir oublié!

Petit rappel au diffuseur de médias Radio-Canada, il semble avoir oublié!